oriTDB
The information of the oriT region
oriTDB accession number 100479
Name oriT_pNDM-KN  insolico
Sequence Completeness intact
oriT length 551 nt
oriT sequence GAGCAGAGCTATGTGTGACAAGAAGTATAGAAATTACGAGGTAGCCATCATGGTCGATGT GAACCCTTTCGACAGGGTTATGAATGAATTGAAAAGTCGTGGCCGCAAGAACGCTCACAT CCTGAGCATCCTCCAATTCGACTGGCCTGCATCGGAGGCCATCATCGAGAAGCTGAGCTG CTACATCACAGACGGGATTAAGGCTAATCAGGAGCCTGTGATTTACCCGATCATTGAAGA AGCTCTGCATCGCTACAGCCAGCTCGTGTTTCATGAGCAGAGAGAGAAATATGAAGACCC GGCCAGAATTGGGGCATTTCTGGAAACCCTGATCACCGAAACCTGCCGGGCGTTGGAAGT GCAAATTGTCGATAGTGGCGGTGATTCATGGTCTGTCGATTCAGGAGAGTCGTTCTCACT GTGGCTTTCTTCCCATCCAGGAGAACTATCCATTAACCCGCAGCCCCATGAGGATGAGAC CTCTTTGCGTGGCTTGCTGTATGAGCTCATCACCTGTGAGAGCGTGAAAACTGTTTTAAG GAGAACCGACT
IR (inverted repeat)IR1: [62-70] [71-79] nt  (AACCCTTTC..GACAGGGTT)
IR2: [143-150] [154-161] nt  (TGGCCTGC..GGAGGCCA)
Location of nic site _
Conserved sequence flanking the
  nic site
_
Note predicted by the oriTfinder
L: 62-70;R:71-79;L:143-150;R:154-161
Visualization of oriT structure
Reference
 N/A
I. Information of Relaxase
ID 550
Name TraI_pNDM-KN insolico
GenBank accession number YP_006958655
Family MOBH
Length 990 aa
UniProt ID _
PDB ID _
Pfam TraI_2 [PF07514.10], Evalue: 6.50E-102, Aligned region: 44..362
Note putative relaxase
Protein sequence [Download] MLKALNKLFGGRSGVIETAPSVRVLPLKDVEDEEIPRYPPFAKGLPVAPLDKILATQAEL
IEKVRNSLGFTVDDFNRLVLPVIQRYAAFVHLLPASESHHHRGAGGLFRHGLEVAFWAAQ
ASESVIFSIEGTPRERRDNEPRWRLASCFSGLLHDVGKPLSDVSITDKDGSITWNPYSES
LHDWAHRHEIDRYFIRWRDKRHKRHEQFSLLAVDRIIPAETREFLSKSGPSIMEAMLEAI
SGTSVNQPVTKLMLRADQESVSRDLRQSRLDVDEFSYGVPVERYVFDAIRRLVKTGKWKV
NEPGAKVWHLNQGVFIAWKQLGDLYDLISHDKIPGIPRDPDTLADILIERGFAVPNTVQE
KGERAYYRYWEVLPEMLQEAAGSVKILMLRLESNDLVFTTEPPAAVAAEVVGDVEDAEIE
FVDPEEVDDDQEEDVSALNDDMLAAEQEAEKALAGLGFGDAMEMLKSTSDAVEEKPEQKD
AGSTESSKPDAGKKGKPQSKPGKAKPKSDTEKQPHKPEAKEDLSPQDIAKNAPPLANDNP
LQALKDVGGGLGDIDFPFDAFSASAETASTDATNSEIPDVAMPGKQEKQPKQDFVPQEQN
SLQGDDFPMFGSSDEPPSWAIEPLPMLTDAPEQTTPAPAMPPTDKPNLHEKDAKTLLVEM
LAGYGEASALLEQAIMPVLEGKTTLGEVLCLMKGQAVILYPDGARSLGAPSEVLSKLSHA
NAIVPDPIMPGRKVRDFSGVKAIVLAEQLSDAVVAAIKDAEASMGGYQDAFELVSPPGLD
ASKNKSAPKQQSRKKAQQQKPEVNAGKPSPEQKAKGKDSQPQQKEKKVDVTSPVEEPQRQ
PVQEKQNVARLPKREVQPVAPEPKVEREKELGHVEVREREEPEVREFEPPKAKTNPKDIN
AEDFLPSGVTPQKALQMLKDMIQKRSGRWLVTPVLEEDGCLVTSDKAFDMIAGENIGISK
HILCGMLSRAQRRPLLKKRQGKLYLEVNET
Reference
 N/A

II. Auxiliary DNA-binding protein(s) of the relaxosome
 N/A
 N/A
Information of plasmid
ID 940
Plasmid name pNDM-KN
GenBank accession number NC_019153.1
Incompatibility group IncA/C2
Genome size 162746 bp
Coordinate of oriT  [Strand] 11380..11930 [-]
Drug resistance insolico Bleomycin resistance; Chloramphenicol resistance
Heavy-metal resistance _
Virulence factor _
Xenobiotic degradation _
Host bacterium [NCBI Taxonomy ID] Klebsiella pneumoniae Kp7 [573]
Reference
[1] Carattoli A et al (2012) Evolution of IncA/C blaCMY-₿carrying plasmids by acquisition of the blaNDM-₿carbapenemase gene. Antimicrob Agents Chemother. 56(2):783-6. [PMID:22123704]