oriTDB
The information of the oriT region
oriTDB accession number 100433
Name oriT_pHUSEC41-3  insolico
Sequence Completeness intact
oriT length 88 nt
oriT sequence TCAGGGGGTTTCGGGGCGAAGCCCTGAACCAGTCACGTAGCGATAGCGGAGTGTATACTG GCTTAACTATGCGGCATCAGTGCAGATT
IR (inverted repeat)[8-17] [21-30] nt  (GTTTCGGGGC..GCCCTGAACC)
Location of nic site [61-62] nt
Conserved sequence flanking the
  nic site
CTGG|CTTA
Note predicted by the oriTfinder
L:8-17;R:21-30;D:61-62
Visualization of oriT structure
Reference
 N/A
I. Information of Relaxase
ID 504
Name Mob_pHUSEC41-3 insolico
GenBank accession number YP_006940173
Family MOBP
Length 517 aa
UniProt ID G4VUT8
PDB ID _
Pfam Relaxase [PF03432.13], Evalue: 1.90E-19, Aligned region: 49..246
Note putative relaxase
Protein sequence [Download] MIVKFHARGKGGGSGPVDYLLGRERNREGATVLQGDPEEVRELIDATPFAKKYTSGVLSF
AEKELPPGGREKVMASFERVLMPGLEKNQYSILWVEHQDKGRLELNFVIPNMELQTGKRL
QPYYDRADRPRIDAWQTLVNHHYGLHDPNAPENRRILTLPDNLPETKQALAESVTRGIDA
LYHVGEIKGRQDVIQALTEAGLEVVRVTRSSISIADPNGGKNIRLKGAFYEQSFTDGRGV
REKAERESRIYRDNAERRVQQARKICKQGCDIKRDENQRRYSPVHSFDRGITEKTPGRGE
RGDDAAQEGRVKAGREYGHDVTGDGHFPVYREWRDALVSWRDDTGEPGRNQDTGRNIAET
EREDMGRGVCAGREKEISGYPAGEIGNGDSLSGEGLGTTDGVTQSDGAGKTFAERLRATA
TGLYAAAERMGERLRGIAENVFAYATGQRDAERAGHAVESAGAALERADRTLEPVIQREQ
EIRDERLIQEREHELSLERERQPEIQERTLDGPSLGW
Reference
 N/A

II. Auxiliary DNA-binding protein(s) of the relaxosome
 N/A
 N/A
Information of plasmid
ID 894
Plasmid name pHUSEC41-3
GenBank accession number NC_018997.1
Incompatibility group ColRNAI
Genome size 7930 bp
Coordinate of oriT  [Strand] 827..914 [-]
Drug resistance _
Heavy-metal resistance _
Virulence factor _
Xenobiotic degradation _
Host bacterium [NCBI Taxonomy ID] Escherichia coli HUSEC41 [562]
Reference
[1] K√ľnne C et al (2012) Complete sequences of plasmids from the hemolytic-uremic syndrome-associated Escherichia coli strain HUSEC41. J Bacteriol. 194(2):532-3. [PMID:22207742]