ID | 402 |
Name | pEK499_p088_pEK499 |
GenBank accession number | YP_003108353 |
Family | MOBC |
Length | 101 aa |
UniProt ID | Q0ZKT4 |
PDB ID | _ |
Pfam | PadR [PF03551.13], Evalue: 4.70E-21, Aligned region: 15..85 HTH_34 [PF13601.5], Evalue: 2.60E-08, Aligned region: 27..94 |
Note | putative relaxase |
Protein sequence [Download] | MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTS RHERTGRRERRVYDITEQGRTALADAKTKVKELFGELVEGG |
ID | 792 |
Plasmid name | pEK499 |
GenBank accession number | NC_013122.1 |
Incompatibility group | IncFIA |
Genome size | 117536 bp |
Coordinate of oriT [Strand] | 26046..26495 [-] |
Drug resistance | resistance to ampicillin, aztreonam, cefotaxime, cefpirome, piperacillin, sulfamethoxazole, and trimethoprim |
Heavy-metal resistance | _ |
Virulence factor | virulence-associated protein VagC and VagD |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Escherichia coli A [562] |
[1] Woodford N et al (2009) Complete nucleotide sequences of plasmids pEK204, pEK499, and pEK516, encoding CTX-M enzymes in three major Escherichia coli lineages from the United Kingdom, all belonging to the international O25:H4-ST131 clone. Antimicrob Agents Chemother. 53(10):4472-82. [PMID:19687243] |