oriTDB
The information of the oriT region
oriTDB accession number 100250
Name oriT_pRK2  insolico
Sequence Completeness intact
oriT length 175 nt
oriT sequence GGTTTCGGGGCGAAGCCCTGAACCAGTCACGTAGCGATAGCGGAGTGTATACTGGCTTAC TATGTTGGCATGGATGCGGAAATCAGTGAAGTGCTTCATGTGACAGGAGAAAAAAGGCGG CACAGGCGCGTCAGCAGAATATGCGATACAGGATATATTCCGCTTCCTCGCTCAC
IR (inverted repeat)[2-11] [15-24] nt  (GTTTCGGGGC..GCCCTGAACC)
Location of nic site [55-56] nt
Conserved sequence flanking the
  nic site
CTGG|CTTA
Note predicted by the oriTfinder
L:2-11;R:15-24;D:55-56
Visualization of oriT structure
Reference
 N/A
I. Information of Relaxase
ID 321
Name MobA_pRK2 insolico
GenBank accession number YP_052693
Family MOBP
Length 517 aa
UniProt ID Q6GUF9
PDB ID _
Pfam Relaxase [PF03432.13], Evalue: 4.80E-19, Aligned region: 49..246
Note putative relaxase
Protein sequence [Download] MIVKFHARGKGGGSGPVDYLLGRERNREGATVLQGNPEEVRELIDATPFAKKYTSGVLSF
AEKELPPGGREKVMESFERVLMPGLEKNQYSILWVEHQDKGRLELNFVIPNMELQTGKRL
QPYYDRADRPRIDAWQTLVNHHYGLHDPNAPENRRTLILPDNLPETKQALAESVTRGLEV
LYHAGEIKGRQDVIQALTEVGLEVVRVTRSSISIADPNGGRNIRLKGAFYEQSFTDGRGV
REKAERESRIYRENAERRIQQARRICQRGCDLKRDENQRRYSPVYGLDGGIAEKTPGRGE
RGDDAAPEGHVKAGREFGHEVAGDSLSPVYREWRDALVSRREDTDEPGRNQGTGRDIAET
EREDMGCGVCSGRGKKISGHSARDVSRGDALSGEGLDTTDGVIRNDRVGNTFAERLRAAA
TGLYAAAERMGERLRGIAEDVFAYATGQRDAERAGHAVESAGTELERADRTLEPVIQREL
EIREERLIQEREHALSLERERQPEIQERTLDGPSLGW
Reference
 N/A

II. Auxiliary DNA-binding protein(s) of the relaxosome
 N/A
 N/A
Information of plasmid
ID 712
Plasmid name pRK2
GenBank accession number NC_005970.1
Genome size 5360 bp
Coordinate of oriT  [Strand] 1049..1223 [-]
Drug resistance _
Heavy-metal resistance _
Virulence factor _
Xenobiotic degradation _
Host bacterium [NCBI Taxonomy ID] Escherichia coli ATCC 9637 [562]
Reference
[1] Step√°nek V et al (2005) Cryptic plasmid pRK2 from Escherichia coli W: sequence analysis and segregational stability. Plasmid. 54(1):86-91. [PMID:15907542]
[2] Sobotkov√° L et al (1999) Indigenous plasmids in a production line of strains for penicillin G acylase derived from Escherichia coli W. Folia Microbiol (Praha). 44(3):263-6. [PMID:10664880]