 oriTDB accession number | 100208 |
| Name | oriT_pAM373  |
Sequence Completeness  | incomplete |
| oriT length | 13 nt |
| oriT sequence | TAAAATGGTCAGG |
| IR (inverted repeat) | _ |
| Location of nic site | [6-7] nt |
| Conserved sequence flanking the nic site | _ |
| Note | CloDF13 familiy |
Visualization of oriT structure Reference| [1] Francia MV et al (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531] |
| [2] Francia MV et al (2002) Transfer origins in the conjugative Enterococcus faecalis plasmids pAD1 and pAM373: identification of the pAD1 nic site, a specific relaxase and a possible TraG-like protein. Mol Microbiol. 45(2):375-95. [PMID:12123451] |
| ID | 201 |
| Name | TraG_pAM373 |
| SecReT4 accesion number | _ |
| GenBank accession number | NP_072029 |
| Family | _ |
| Length | 423 |
| UniProt ID | Q9F1G0 |
| PDB ID | _ |
| Pfam | CHAP [PF05257.15], Evalue: 8.20E-18, Aligned region: 299..393 Glucosaminidase [PF01832.19], Evalue: 1.30E-06, Aligned region: 68..216 |
| Note | traG-related protein |
| Protein sequence [Download] | MNKKRIVFGLLSFFLPIFLVFGGLLFFLLLLTSTSDTSKNDCIQPSINNPTDATDTPKSI EQFVKSHKDAYLLSWKAGGFLPSASISQTMVENGFNFTNPSGTSFWQAHNMGGVKTSKKE DFPVTLATFGQDSVDISGTKPGSNVGDGTGGAYTWFKDYNAGIVGKAEFMAHQTLYTGAI NNTDGLSTLSAIYSGGWATDPTYLMKLQATYNSLGKQFQWLDQEAIQKYGNAPFKKSELV PNIPGKSPITNEKSGKNSDCVVTSDTSDQVTGQNTAPSLEVPSAYKGKLTLPPIDSNDYA GNNYPFGQCTWYAYNRMAQIGKPIEWFSGDGGNGAGWANSARAKGYTVVKGKPSVGWAAS MQGGIGGSAPPYGHVAVVEYVNSDGSILVSEANVINQGSGTRSWRVLDRATVEQIDFIQG KGA |
Reference| [1] Francia MV et al (2004) Transfer origins in the conjugative Enterococcus faecalis plasmids pAD1 and pAM373: identification of the pAD1 nic site, a specific relaxase and a possible TraG-like protein. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531] |
| [2] Francia MV et al (2002) Transfer origins in the conjugative Enterococcus faecalis plasmids pAD1 and pAM373: identification of the pAD1 nic site, a specific relaxase and a possible TraG-like protein. Mol Microbiol. 45(2):375-95. [PMID:12123451] |
| ID | 201 |
| Plasmid name | pAM373 |
| GenBank accession number | NC_002630.1 |
| Genome size | 36804 bp |
| Coordinate of oriT [Strand] | 14431..14443 [-] |
| Drug resistance | _ |
| Heavy-metal resistance | _ |
| Virulence factor | _ |
| Xenobiotic degradation | _ |
| Host bacterium [NCBI Taxonomy ID] | Enterococcus faecalis [1351] |
Reference