 oriTDB accession number | 100183 |
| Name | oriT_pMV158  |
Sequence Completeness  | core |
| oriT length | 41 nt |
| oriT sequence | CACTTTATGAATATAAAGTATAGTGTGTTATACTTTACATG |
| IR (inverted repeat) | [2-8] [13-19] nt (ACTTTAT..ATAAAGT) |
| Location of nic site | [27-28] nt |
| Conserved sequence flanking the nic site | TAGTGTG|TTAT |
| Note | The conserved recombination site (RSA): AAGTATAGTGTG|TTATACT |
Visualization of oriT structure (The oriT was characterized experimentally) Reference| [1] Grohmann E et al (2003) Conjugative plasmid transfer in gram-positive bacteria. Microbiol Mol Biol Rev. 67(2):277-301. [PMID:12794193] |
| [2] Grohmann E et al (1999) Mobilisation of the streptococcal plasmid pMV158: interactions of MobM protein with its cognate oriT DNA region. Mol Gen Genet. 261(4-5):707-15. [PMID:10394908] |
| [3] Guzmán LM et al (1997) The mobilization protein, MobM, of the streptococcal plasmid pMV158 specifically cleaves supercoiled DNA at the plasmid oriT. Mol Gen Genet. 266(4):688-702. [PMID:9102462] |
| [4] Priebe SD et al (1989) Region of the streptococcal plasmid pMV158 required for conjugative mobilization. J Bacteriol. 171(9):4778-84. [PMID:2768188] |
| [5] Farías ME et al (2000) Conjugal transfer of plasmid pMV158: uncoupling of the pMV158 origin of transfer from the mobilization gene mobM, and modulation of pMV158 transfer in Escherichia coli mediated by IncP plasmids. Microbiology. 146 (Pt 9):2259-65. [PMID:10974113] |
| [6] Turgeon N et al (2001) Isolation and characterization of a Streptococcus thermophilus plasmid closely related to the pMV158 family. Plasmid. 45(3):171-83. [PMID:11407913] |
| [7] Francia MV et al (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531] |
| [8] Alippi AM et al (2014) Tetracycline-resistance encoding plasmids from Paenibacillus larvae, the causal agent of American foulbrood disease, isolated from commercial honeys. Int Microbiol. 17(1):49-61. [PMID:25296446] |
| [9] Tomita H et al (2005) Genetic analysis of transfer-related regions of the vancomycin resistance Enterococcus conjugative plasmid pHTbeta: identification of oriT and a putative relaxase gene. J Bacteriol. 187(22):7727-37. [PMID:16267297] |
| ID | 176 |
| Name | MobM_pMV158 |
| GenBank accession number | YP_001586274 |
| Family | MOBV |
| Length | 494 aa |
| UniProt ID | P13925 |
| PDB ID | 4LVI, 4LVJ, 4LVK, 4LVL, 4LVM |
| Pfam | Mob_Pre [PF01076.18], Evalue: 3.30E-74, Aligned region: 1..194 |
| Note | mobilization peptide |
| Protein sequence [Download] | MSYMVARMQKMKAGNLGGAFKHNERVFETHSNKDINPSRSHLNYELTDRDRSVSYEKQIK DYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNI AYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKL NSEAKHKTVAEFKRAMADMELKEELLEKYHAPPFVDERTGELNNDTEAFWHEKEFADMFE VQSPIRETTNQEKMDWLRKQYQEELKKLESSKKPLEDDLSHLEELLDKKTKEYIKIDSEA SERASELSKAEGYINTLENHSKSLEAKIECLESDNLQLEKQKATKLEAKALNESELRELK PKKNFLGKEHYELSPEQFEGLKAEVYRSRTLLHHKDIELEQAKRQVSLRASKNYFTASLE RAKEKAKGESIDRLKSEIKRLKNENSILRQQNDKMLGKLRELMPDKAFKNLLSELKAIKP IVNIIKKAIEKSLF |
Reference| [1] Grohmann E et al (2003) Conjugative plasmid transfer in gram-positive bacteria. Microbiol Mol Biol Rev. 67(2):277-301. [PMID:12794193] |
| [2] Grohmann E et al (1999) Mobilisation of the streptococcal plasmid pMV158: interactions of MobM protein with its cognate oriT DNA region. Mol Gen Genet. 261(4-5):707-15. [PMID:10394908] |
| [3] Guzmán LM et al (1997) The mobilization protein, MobM, of the streptococcal plasmid pMV158 specifically cleaves supercoiled DNA at the plasmid oriT. Mol Gen Genet. 266(4):688-702. [PMID:9102462] |
| [4] Priebe SD et al (1989) Region of the streptococcal plasmid pMV158 required for conjugative mobilization. J Bacteriol. 171(9):4778-84. [PMID:2768188] |
| [5] Farías ME et al (2000) Conjugal transfer of plasmid pMV158: uncoupling of the pMV158 origin of transfer from the mobilization gene mobM, and modulation of pMV158 transfer in Escherichia coli mediated by IncP plasmids. Microbiology. 146 (Pt 9):2259-65. [PMID:10974113] |
| # | ID | Name | GenBank | Length | Note |
| 1 | 254 | _  | _ | _ | _ |
| ID | 176 |
| Plasmid name | pMV158 |
| GenBank accession number | NC_010096.1 |
| Genome size | 5541 bp |
| Coordinate of oriT [Strand] | 3570..3610 [+] |
| Drug resistance | _ |
| Heavy-metal resistance | _ |
| Virulence factor | _ |
| Xenobiotic degradation | _ |
| Host bacterium [NCBI Taxonomy ID] | Streptococcus agalactiae [1311] |
Reference