[1] Grohmann E et al (2003) Conjugative plasmid transfer in gram-positive bacteria. Microbiol Mol Biol Rev. 67(2):277-301. [PMID:12794193] |
[2] Grohmann E et al (1999) Mobilisation of the streptococcal plasmid pMV158: interactions of MobM protein with its cognate oriT DNA region. Mol Gen Genet. 261(4-5):707-15. [PMID:10394908] |
[3] Guzmán LM et al (1997) The mobilization protein, MobM, of the streptococcal plasmid pMV158 specifically cleaves supercoiled DNA at the plasmid oriT. Mol Gen Genet. 266(4):688-702. [PMID:9102462] |
[4] Priebe SD et al (1989) Region of the streptococcal plasmid pMV158 required for conjugative mobilization. J Bacteriol. 171(9):4778-84. [PMID:2768188] |
[5] Farías ME et al (2000) Conjugal transfer of plasmid pMV158: uncoupling of the pMV158 origin of transfer from the mobilization gene mobM, and modulation of pMV158 transfer in Escherichia coli mediated by IncP plasmids. Microbiology. 146 (Pt 9):2259-65. [PMID:10974113] |
[6] Turgeon N et al (2001) Isolation and characterization of a Streptococcus thermophilus plasmid closely related to the pMV158 family. Plasmid. 45(3):171-83. [PMID:11407913] |
[7] Francia MV et al (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531] |
[8] Alippi AM et al (2014) Tetracycline-resistance encoding plasmids from Paenibacillus larvae, the causal agent of American foulbrood disease, isolated from commercial honeys. Int Microbiol. 17(1):49-61. [PMID:25296446] |
[9] Tomita H et al (2005) Genetic analysis of transfer-related regions of the vancomycin resistance Enterococcus conjugative plasmid pHTbeta: identification of oriT and a putative relaxase gene. J Bacteriol. 187(22):7727-37. [PMID:16267297] |
![]() | 176 |
![]() | MobM_pMV158 ![]() |
![]() | YP_001586274 |
![]() | MOBV |
![]() | 494 aa |
![]() | P13925 |
![]() | 4LVI, 4LVJ, 4LVK, 4LVL, 4LVM |
![]() | Mob_Pre [PF01076.18], Evalue: 3.30E-74, Aligned region: 1..194 |
![]() | mobilization peptide |
![]() | MSYMVARMQKMKAGNLGGAFKHNERVFETHSNKDINPSRSHLNYELTDRDRSVSYEKQIK DYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRTFFETAKNYFAENYGESNI AYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHIQEDLPRYMSDHGFELERGKL NSEAKHKTVAEFKRAMADMELKEELLEKYHAPPFVDERTGELNNDTEAFWHEKEFADMFE VQSPIRETTNQEKMDWLRKQYQEELKKLESSKKPLEDDLSHLEELLDKKTKEYIKIDSEA SERASELSKAEGYINTLENHSKSLEAKIECLESDNLQLEKQKATKLEAKALNESELRELK PKKNFLGKEHYELSPEQFEGLKAEVYRSRTLLHHKDIELEQAKRQVSLRASKNYFTASLE RAKEKAKGESIDRLKSEIKRLKNENSILRQQNDKMLGKLRELMPDKAFKNLLSELKAIKP IVNIIKKAIEKSLF |
[1] Grohmann E et al (2003) Conjugative plasmid transfer in gram-positive bacteria. Microbiol Mol Biol Rev. 67(2):277-301. [PMID:12794193] |
[2] Grohmann E et al (1999) Mobilisation of the streptococcal plasmid pMV158: interactions of MobM protein with its cognate oriT DNA region. Mol Gen Genet. 261(4-5):707-15. [PMID:10394908] |
[3] Guzmán LM et al (1997) The mobilization protein, MobM, of the streptococcal plasmid pMV158 specifically cleaves supercoiled DNA at the plasmid oriT. Mol Gen Genet. 266(4):688-702. [PMID:9102462] |
[4] Priebe SD et al (1989) Region of the streptococcal plasmid pMV158 required for conjugative mobilization. J Bacteriol. 171(9):4778-84. [PMID:2768188] |
[5] Farías ME et al (2000) Conjugal transfer of plasmid pMV158: uncoupling of the pMV158 origin of transfer from the mobilization gene mobM, and modulation of pMV158 transfer in Escherichia coli mediated by IncP plasmids. Microbiology. 146 (Pt 9):2259-65. [PMID:10974113] |
# | ID | Name | GenBank | Length | Note |
1 | 254 | _ ![]() | _ | _ | _ |
![]() | 176 |
![]() | pMV158 |
![]() | NC_010096.1 |
![]() | 5541 bp |
![]() | 3570..3610 [+] |
![]() | _ |
![]() | _ |
![]() | _ |
![]() | _ |
![]() | Streptococcus agalactiae [1311] |