[1] Rohrer J et al (1992) Sequence analysis and characterization of the mobilization region of a broad-host-range plasmid, pTF-FC2, isolated from Thiobacillus ferrooxidans. J Bacteriol. 174(19):6230-7. [PMID:1400173] |
[2] van Zyl LJ et al (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022] |
[3] Rawlings DE (2005) The evolution of pTF-FC2 and pTC-F14, two related plasmids of the IncQ-family. Plasmid. 53(2):137-47. [PMID:15737401] |
![]() | 171 |
![]() | MobA_pTF-FC2 ![]() |
![]() | AAA27389 |
![]() | MOBP |
![]() | 409 aa |
![]() | P22898 |
![]() | _ |
![]() | Relaxase [PF03432.13], Evalue: 2.20E-28, Aligned region: 5..217 |
![]() | relaxase |
![]() | MIALSQEAVRSKDTINHYVLSWREGEQPSPEQVEEAVSIFMDELGVKDHQAIYGLHADTD NLHLHLAINRVHPETLKVVKINNGFDIEAAHKAIARIENAQGWQREQNGRYQVLENGELG REHIDKDKPRQPAQPKRDMENRTGEKSAERIAIEDGAPIIKKAQTWEQLHRELAAKGMRY EKTGSGATLFVGDVGVKASSADRDASLSKLQKRLGAYQPPQRQQVAQREPEPIKPDVPGW KDYITGRKAHYSEKNADKLVQDKRQEQERKQLAEQQKARRDELMRGNWKGKGEVLNAMRS VIAAEQAAEKAALKEKHQKQREQHRQQFRPYPDLEQWQRMQKSPELAEQWRHRASEPQRI EGDRSEPPTPRDIRAYQPEIVGQQVHYSRKEEGGRGGGVSFVDKGKSID |
[1] van Zyl LJ et al (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022] |
# | ID | Name | GenBank | Length | Note |
1 | 246 | MobB_pTF-FC2 ![]() | B43256 | 106 aa | relaxosome component |
2 | 247 | MobC_pTF-FC2 ![]() | AAA27390 | 118 aa | relaxosome component |
![]() | 171 |
![]() | pTF-FC2 |
![]() | M57717.1 |
![]() | IncQ2 |
![]() | 12.2 kb |
![]() | _ |
![]() | _ |
![]() | ![]() |
![]() | _ |
![]() | _ |
![]() | Thiobacillus ferrooxidans FC1 [920] |
[1] Smith AS et al (1997) The poison-antidote stability system of the broad-host-range Thiobacillus ferrooxidans plasmid pTF-FC2. Mol Microbiol. 26(5):961-70. [PMID:9426133] |
[2] Rohrer J et al (1992) Sequence analysis and characterization of the mobilization region of a broad-host-range plasmid, pTF-FC2, isolated from Thiobacillus ferrooxidans. J Bacteriol. 174(19):6230-7. [PMID:1400173] |