[1] Rohrer J et al (1992) Sequence analysis and characterization of the mobilization region of a broad-host-range plasmid, pTF-FC2, isolated from Thiobacillus ferrooxidans. J Bacteriol. 174(19):6230-7. [PMID:1400173] |
[2] van Zyl LJ et al (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022] |
[3] Rawlings DE (2005) The evolution of pTF-FC2 and pTC-F14, two related plasmids of the IncQ-family. Plasmid. 53(2):137-47. [PMID:15737401] |
ID | 171 |
Name | MobA_pTF-FC2 |
GenBank accession number | AAA27389 |
Family | MOBP |
Length | 409 aa |
UniProt ID | P22898 |
PDB ID | _ |
Pfam | Relaxase [PF03432.13], Evalue: 2.20E-28, Aligned region: 5..217 |
Note | relaxase |
Protein sequence [Download] | MIALSQEAVRSKDTINHYVLSWREGEQPSPEQVEEAVSIFMDELGVKDHQAIYGLHADTD NLHLHLAINRVHPETLKVVKINNGFDIEAAHKAIARIENAQGWQREQNGRYQVLENGELG REHIDKDKPRQPAQPKRDMENRTGEKSAERIAIEDGAPIIKKAQTWEQLHRELAAKGMRY EKTGSGATLFVGDVGVKASSADRDASLSKLQKRLGAYQPPQRQQVAQREPEPIKPDVPGW KDYITGRKAHYSEKNADKLVQDKRQEQERKQLAEQQKARRDELMRGNWKGKGEVLNAMRS VIAAEQAAEKAALKEKHQKQREQHRQQFRPYPDLEQWQRMQKSPELAEQWRHRASEPQRI EGDRSEPPTPRDIRAYQPEIVGQQVHYSRKEEGGRGGGVSFVDKGKSID |
[1] van Zyl LJ et al (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022] |
# | ID | Name | GenBank | Length | Note |
1 | 246 | MobB_pTF-FC2 | B43256 | 106 aa | relaxosome component |
2 | 247 | MobC_pTF-FC2 | AAA27390 | 118 aa | relaxosome component |
ID | 171 |
Plasmid name | pTF-FC2 |
GenBank accession number | M57717.1 |
Incompatibility group | IncQ2 |
Genome size | 12.2 kb |
Coordinate of oriT [Strand] | _ |
Drug resistance | _ |
Heavy-metal resistance | contains merA (mercury reductase) gene |
Virulence factor | _ |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Thiobacillus ferrooxidans FC1 [920] |
[1] Smith AS et al (1997) The poison-antidote stability system of the broad-host-range Thiobacillus ferrooxidans plasmid pTF-FC2. Mol Microbiol. 26(5):961-70. [PMID:9426133] |
[2] Rohrer J et al (1992) Sequence analysis and characterization of the mobilization region of a broad-host-range plasmid, pTF-FC2, isolated from Thiobacillus ferrooxidans. J Bacteriol. 174(19):6230-7. [PMID:1400173] |