 oriTDB accession number | 100174 |
| Name | oriT_pIP421  |
Sequence Completeness  | incomplete |
| oriT length | 7 nt |
| oriT sequence | CAAGCTC |
| IR (inverted repeat) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site | _ |
| Note | The oriT region was determined experimentally, but the putative nic site was not determined experimentally. |
Visualization of oriT structure (The oriT was characterized experimentally) Reference| [1] Trinh S et al (1997) Identification and DNA sequence of the mobilization region of the 5-nitroimidazole resistance plasmid pIP421 from Bacteroides fragilis. J Bacteriol. 179(12):4071-4. [PMID:9190830] |
| ID | 167 |
| Name | Mob421_pIP421  |
| GenBank accession number | CAA71505 |
| Family | Other |
| Length | 425 aa |
| UniProt ID | P96200 |
| PDB ID | _ |
| Pfam | |
| Note | A member of the Bacteroides mobilization protein family, which includes the MobA of pBI143, NBUs, and Tn4555 |
| Protein sequence [Download] | MAKTSINVRPCNIGSAERHNLRSKELDYIRPELSHRNEQWSEMKIADVLEDIREKYRQHT GQSMQKKATPIREGVVVIEDGTTLRQLQDFAGRLEERFGIHTFQIYTHKDERASVWDGNA ETWKPNYHAHMIFDWTDGETGRTRKLNKQDMAEMQTILAECLGMERGISSDRKLLSAIQY KNMVEAEKAAQIEKECSQMEDERNAIEEKVKQAGQKLEDTQKKLKEAAAEIKVEKLKGAA ADTGTALLKAGTTVIDVTRSLFNSGKVKRQEQEIAELKRENYELEMKSQNLQSNLRTANA QNEREREATRRAVRTGEERLKPITNLFPCMENAKENIEELREMGVRDNDIRLLLTGKEIT YSGFLYDRERRKKHQVKNVKINIAKSKAGNTTIWLNDFHFKEFFKQLWQKLQKVLGIDKG RGFHL |
Reference| [1] Trinh S et al (1997) Identification and DNA sequence of the mobilization region of the 5-nitroimidazole resistance plasmid pIP421 from Bacteroides fragilis. J Bacteriol. 179(12):4071-4. [PMID:9190830] |
| # | ID | Name | GenBank | Length | Note |
| 1 | 240 | _ |
| ID | 167 |
| Plasmid name | pIP421 |
| GenBank accession number | Y10480.1 |
| Genome size | 7.3 kb |
| Coordinate of oriT [Strand] | 513..519 [+] |
| Drug resistance | 5-nitroimidazole |
| Heavy-metal resistance | _ |
| Virulence factor | _ |
| Xenobiotic degradation | _ |
| Host bacterium [NCBI Taxonomy ID] | Bacteroides fragilis BF-F239 [817] |
Reference| [1] Trinh S et al (1997) Identification and DNA sequence of the mobilization region of the 5-nitroimidazole resistance plasmid pIP421 from Bacteroides fragilis. J Bacteriol. 179(12):4071-4. [PMID:9190830] |