 oriTDB accession number | 100116 |
| Name | oriT_pSC101  |
Sequence Completeness  | core |
| oriT length | 45 nt |
| oriT sequence | GGGCGCACGTTTCTGAACGAAGTGAAGAAAGTCTAAGTGCGCCCT |
| IR (inverted repeat) | [10-18] [22-30] nt (TTTCTGAAC.. GTGAAGAAA) |
| Location of nic site | [41-42] nt |
| Conserved sequence flanking the nic site | TAAGTGCG|CCCT |
| Note | IncQ type mobilizable plasmid |
Visualization of oriT structure (The oriT was characterized experimentally) Reference| [1] Meyer R (2000) Identification of the mob genes of plasmid pSC101 and characterization of a hybrid pSC101-R1162 system for conjugal mobilization. J Bacteriol. 182(17):4875-81. [PMID:10940031] |
| [2] Jandle S et al (2006) Stringent and relaxed recognition of oriT by related systems for plasmid mobilization: implications for horizontal gene transfer. J Bacteriol. 188(2):499-506. [PMID:16385040] |
| [3] Parker C et al (2005) Elements in the co-evolution of relaxases and their origins of transfer. Plasmid . 53(2):113-8. [PMID:15737398] |
| ID | 111 |
| Name | MobA_pSC101 |
| GenBank accession number | NP_044284 |
| Family | MOBQ |
| Length | 371 aa |
| UniProt ID | P14492 |
| PDB ID | _ |
| Pfam | MobA_MobL [PF03389.14], Evalue: 1.10E-30, Aligned region: 17..224 |
| Note | relaxase |
| Protein sequence [Download] | MASYHLSVKTGGKGSASPHADYIAREGKYAREKDSDLEHKESGNMPAWAAHKPSEFWKAA DTSERANGCTYREIEIALPRELKPEQRLELVRDFVQQEIGDRHAYQFAIHNPKAAIAGGE QPHAHIMFSERINDGIHRDPEQYFKRANTKEPDAVAQKRHVSGKHRPNAKNTLLPRGRRW ADLQNKHLERYQHADRVDSRSLKAQGIDREPERHLGAGQVQRFDTEQLQAILERREAERQ VQQSRDERDSVIDVTTSLREALSERDTLTLKQELKSEPEQESHSGRTFDFEKEPDKLNAL VSDAMKDIQEEIDLQSLVNDAMAEFQGIHQEMERQRERERLAEKQRQQEKERQRLAEQIR QKPDKGWSFSR |
Reference| [1] Meyer R (2000) Identification of the mob genes of plasmid pSC101 and characterization of a hybrid pSC101-R1162 system for conjugal mobilization. J Bacteriol. 182(17):4875-81. [PMID:10940031] |
| [2] Jandle S et al (2006) Stringent and relaxed recognition of oriT by related systems for plasmid mobilization: implications for horizontal gene transfer. J Bacteriol. 188(2):499-506. [PMID:16385040] |
| [3] Becker EC et al (2012) Origin and fate of the 3' ends of single-stranded DNA generated by conjugal transfer of plasmid R1162. J Bacteriol. 194(19):5368-76. [PMID:22865840] |
| # | ID | Name | GenBank | Length | Note |
| 1 | 167 | MobX_pSC101  | NP_044283 | 194 aa |
| ID | 111 |
| Plasmid name | pSC101 |
| GenBank accession number | NC_002056.1 |
| Incompatibility group | IncQ1 |
| Genome size | 9263 bp |
| Coordinate of oriT [Strand] | 4071..4115 [+] |
| Drug resistance | resistance to tetracycline |
| Heavy-metal resistance | _ |
| Virulence factor | _ |
| Xenobiotic degradation | _ |
| Host bacterium [NCBI Taxonomy ID] | Salmonella enterica serovar Typhimurium [90371] |
Reference| [1] Tait RC et al (1978) On the nature of tetracycline resistance controlled by the plasmid pSC101. Cell. 13(1):73-81. [PMID:340050] |