[1] Zioga A et al (2009) CMY-31 and CMY-36 cephalosporinases encoded by ColE1-like plasmids. Antimicrob Agents Chemother. 53(3):1256-9. [PMID:19104021] |
ID | 109 |
Name | MobB_pA172 |
GenBank accession number | YP_001649325 |
Family | MOBP |
Length | 156 aa |
UniProt ID | B0FJX3 |
PDB ID | _ |
Pfam | |
Note | relaxase |
Protein sequence [Download] | MQQAIRMRIEADSASGKMTETVRQSVNAALTQVEKELKQTGLEQQKPATDAFNQAAGTAK AMIHEMRREMSRYTWKSAIYIAMTMIAVMGGCLWGMYYFIDSGYARVAEMQHMEAVWQKK APLADIKTCDGNPCVKVDISRTFGDKKDTYLIIKGK |
[1] Zioga A et al (2009) CMY-31 and CMY-36 cephalosporinases encoded by ColE1-like plasmids. Antimicrob Agents Chemother. 53(3):1256-9. [PMID:19104021] |
# | ID | Name | GenBank | Length | Note |
1 | 165 | _ |
ID | 109 |
Plasmid name | pA172 |
GenBank accession number | NC_010259.1 |
Genome size | 8197 bp |
Coordinate of oriT [Strand] | 7094..7311 [-] |
Drug resistance | CMY-31 cephalosporinase (blaCMY-type gene) |
Heavy-metal resistance | _ |
Virulence factor | _ |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Salmonella enterica AM17274 [108619] |
[1] Zioga A et al (2009) CMY-31 and CMY-36 cephalosporinases encoded by ColE1-like plasmids. Antimicrob Agents Chemother. 53(3):1256-9. [PMID:19104021] |