[1] Vignoli R et al (2006) New TEM-Derived Extended-Spectrum β-Lactamase and Its Genomic Context in Plasmids from Salmonella enterica Serovar Derby Isolates from Uruguay. Antimicrob Agents Chemother. 50(2):781-4. [PMID:16436745] |
ID | 104 |
Name | MobA_pST12 |
GenBank accession number | YP_008574978 |
Family | MOBP |
Length | 145 aa |
UniProt ID | T2MZH7 |
PDB ID | _ |
Pfam | |
Note | plasmid mobilization protein |
Protein sequence [Download] | MLTGQDVQLLYRAYMHAITITLVRASPRHPMSDTEPCFMTKRSGSNTRRRAISRPVRLTA EEDQEIRKRAAECGKTVSGFLRAAALGKKVNSLTDDRVLKEVMRLGALQKKLFIDGKRVG DREYAEVLIAITEYHRALLSRLMAD |
[1] Vignoli R et al (2006) New TEM-Derived Extended-Spectrum β-Lactamase and Its Genomic Context in Plasmids from Salmonella enterica Serovar Derby Isolates from Uruguay. Antimicrob Agents Chemother. 50(2):781-4. [PMID:16436745] |
# | ID | Name | GenBank | Length | Note |
1 | 156 | _ |
ID | 104 |
Plasmid name | pST12 |
GenBank accession number | NC_022376.1 |
Genome size | 8275 bp |
Coordinate of oriT [Strand] | 5989..6230 [-] |
Drug resistance | TEM-derived extended-spectrum beta-Lactamase (blaTEM gene) |
Heavy-metal resistance | _ |
Virulence factor | _ |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Salmonella enterica serovar Derby str. T12 [1401650] |
[1] Vignoli R et al (2006) New TEM-Derived Extended-Spectrum β-Lactamase and Its Genomic Context in Plasmids from Salmonella enterica Serovar Derby Isolates from Uruguay. Antimicrob Agents Chemother. 50(2):781-4. [PMID:16436745] |