[1] Vignoli R et al (2006) New TEM-Derived Extended-Spectrum β-Lactamase and Its Genomic Context in Plasmids from Salmonella enterica Serovar Derby Isolates from Uruguay. Antimicrob Agents Chemother. 50(2):781-4. [PMID:16436745] |
![]() | 104 |
![]() | MobA_pST12 ![]() |
![]() | YP_008574978 |
![]() | MOBP |
![]() | 145 aa |
![]() | T2MZH7 |
![]() | _ |
![]() | |
![]() | plasmid mobilization protein |
![]() | MLTGQDVQLLYRAYMHAITITLVRASPRHPMSDTEPCFMTKRSGSNTRRRAISRPVRLTA EEDQEIRKRAAECGKTVSGFLRAAALGKKVNSLTDDRVLKEVMRLGALQKKLFIDGKRVG DREYAEVLIAITEYHRALLSRLMAD |
[1] Vignoli R et al (2006) New TEM-Derived Extended-Spectrum β-Lactamase and Its Genomic Context in Plasmids from Salmonella enterica Serovar Derby Isolates from Uruguay. Antimicrob Agents Chemother. 50(2):781-4. [PMID:16436745] |
# | ID | Name | GenBank | Length | Note |
1 | 156 | _ ![]() |
![]() | 104 |
![]() | pST12 |
![]() | NC_022376.1 |
![]() | 8275 bp |
![]() | 5989..6230 [-] |
![]() | ![]() |
![]() | _ |
![]() | _ |
![]() | _ |
![]() | Salmonella enterica serovar Derby str. T12 [1401650] |
[1] Vignoli R et al (2006) New TEM-Derived Extended-Spectrum β-Lactamase and Its Genomic Context in Plasmids from Salmonella enterica Serovar Derby Isolates from Uruguay. Antimicrob Agents Chemother. 50(2):781-4. [PMID:16436745] |