[1] Smalla K et al (2000) Exogenous isolation of antibiotic resistance plasmids from piggery manure slurries reveals a high prevalence and diversity of IncQ-like plasmids. Appl Environ Microbiol. 66(11):4854-62. [PMID:11055935] |
ID | 86 |
Name | MobA_pIE1120 |
GenBank accession number | AAC72343 |
Family | Other |
Length | 40 aa |
UniProt ID | O88171 |
PDB ID | _ |
Pfam | |
Note | Conjugal transfer relaxase TraA; partial sequence |
Protein sequence [Download] | MAIYHLTAKTGSRSGGQSARAKADYIQREGKYARDMDEVL |
[1] Smalla K et al (2000) Exogenous isolation of antibiotic resistance plasmids from piggery manure slurries reveals a high prevalence and diversity of IncQ-like plasmids. Appl Environ Microbiol. 66(11):4854-62. [PMID:11055935] |
# | ID | Name | GenBank | Length | Note |
1 | 125 | MobC_pIE1120 | AAC72342 | 94 aa | mobilization protein MobC |
ID | 86 |
Plasmid name | pIE1120 |
GenBank accession number | AF070999.1 |
Incompatibility group | IncQ1 |
Genome size | 9.1 kb |
Coordinate of oriT [Strand] | 203..290 [+] |
Drug resistance | resistance to tetracycline and streptomycin |
Heavy-metal resistance | _ |
Virulence factor | _ |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Uncultured bacterium [77133] |
[1] Smalla K et al (2000) Exogenous isolation of antibiotic resistance plasmids from piggery manure slurries reveals a high prevalence and diversity of IncQ-like plasmids. Appl Environ Microbiol. 66(11):4854-62. [PMID:11055935] |