oriTDB
The information of the oriT region
oriTDB accession number 100085
Name oriT_pSJ7.4  insolico
Sequence Completeness incomplete
oriT length 55 nt
oriT sequence TAATGCCCACTTAT
IR (inverted repeat)IR1: [16-24] [28-36] nt  (CAGTTTCTC..GAGAAACTG)
IR2: [43-47] [51-55] nt  (AAGCG..CGCTT)
Location of nic site _
Conserved sequence flanking the
  nic site
_
Note _
L:16-24;R:28-36;L:43-47;R:51-55
Visualization of oriT structure
Reference
[1] Rodriguez-Bonano NM et al (2004) Molecular analysis of oriT and MobA protein in the 7.4 kb mobilizable beta-lactamase plasmid pSJ7.4 from Neisseria gonorrhoeae. Plasmid. 52(2):89-101. [PMID:15336487]
I. Information of Relaxase
ID 80
Name MobA_pSJ7.4 insolico
GenBank accession number AAO45530
Family MOBQ
Length 478 aa
UniProt ID Q84AT6
PDB ID _
Pfam MobA_MobL [PF03389.14], Evalue: 2.40E-28, Aligned region: 9..222
Note MobA; relaxase
Protein sequence [Download] MAIYHLNVRYCSKSKGQSAQAKNDYINRNDKYSKRLDDLQFSGYGNMPKFAEDNPQEFWR
LSDIYERANARVCTEIEFALPRELTLEQQQKLVSSFIENTVDSGSNKLPYSFAIHTDKNN
HNPHCHLIFSERQLDGIDRTAEQFFKRANTKSPEKGGAMKTADFRDREFIQSVRKTWREQ
ANQALEQYGYAARIDERSYKEQGIEQAPRARIDRVTWQELNRLEQEERQIVQELALKGQE
INKEKSYLQKIEEKQAQGMGKYESKFAAAFSKLSESALKHDLSNEKEKDSKIHTQEEKVP
QNRIQGLSQADFDQFLIDEWLPQIEKYVKAQEKRDGMEVEITQYDKDLQRIQGDYNKLTD
KNQGFLGLWETKEQKAKKKELEDEYKHTAEQRNAKSQELAEYSQKIKAYEQKTLEPINEK
IAKYQADNPEIKMRSLGFVKKIKAQGAYKAAQERMEREKQHQQEKQQRHLERESGLSL
Reference
[1] Rodriguez-Bonano NM et al (2004) Molecular analysis of oriT and MobA protein in the 7.4 kb mobilizable beta-lactamase plasmid pSJ7.4 from Neisseria gonorrhoeae. Plasmid. 52(2):89-101. [PMID:15336487]


II. Auxiliary DNA-binding protein(s) of the relaxosome
# ID Name GenBank Length Note
1 116 MobC_pSJ7.4 insolico AAO45531 98 aa mobilization protein C
 N/A
Information of plasmid
ID 80
Plasmid name pSJ7.4
GenBank accession number AY221996.1
Genome size 7.4 kb
Coordinate of oriT  [Strand] 1186..1240 [+]
Drug resistance _
Heavy-metal resistance _
Virulence factor _
Xenobiotic degradation _
Host bacterium [NCBI Taxonomy ID] Neisseria gonorrhoeae [485]
Reference
 N/A