[1] Davis RE et al (2005) Cryptic plasmid pSKU146 from the wall-less plant pathogen Spiroplasma kunkelii encodes an adhesin and components of a type IV translocation-related conjugation system. Plasmid. 53(2):179-90. [PMID:15737404] |
ID | 36 |
Name | Mob_pSKU146 |
SecReT4 accesion number | _ |
GenBank accession number | YP_138235 |
Family | TrwB/TraD |
Length | 504 |
UniProt ID | Q5VCB6 |
PDB ID | _ |
Pfam | TrwB_AAD_bind [PF10412.8], Evalue: 4.10E-06, Aligned region: 122..183 TrwB_AAD_bind [PF10412.8], Evalue: 2.00E-09, Aligned region: 265..491 TraG-D_C [PF12696.6], Evalue: 6.10E-11, Aligned region: 351..468 DUF87 [PF01935.16], Evalue: 5.80E-06, Aligned region: 123..357 |
Note | contains VirD4 domain; similar to Mob protein of Streptococcus mutans accession number NP_114056, conjugative coupling factor of Vibrio cholerae GenBank Accession Number AAL59680 |
Protein sequence [Download] | MLKKIINWRDKNISNKIIYWFIFIFVVPFILLCFINCASAIIIMFLKYHTLDFKNFHIAY VDKYSWIISLVLFVIGFLFFLWFYVCHKIDNMDSPKIKQQKSSKASDKEFKTLQLKMLAL NNKYGIPKTNLSQHTILVGTTGSGKTTTLMFLVKQLTQLFKQTTIIIDGKGDIDLINKVK QQDPNAFIWEIGGTTEYNPFATKDSVVLSDKIMSLFTFSEPHYEALVNDYVLILTETLIN KNVELTLENIIKYFDIKELKQLISKKDNNYEYLEKLNEDDILGMRSRLNVYRQQLKTNIG INNKLLELITKHKTILFSINSLMYPKLAGSVGKIIIQDLKELTTLKPVNQKINIVLDEFN VFASETIINLINKSRSFNYQCFLSFQTINDLKTNNMNLTDTIFGNVNSIVCHNIKDPNTT EYVASVFGTQETEKLTRQLDFKNNTADMGSVRSVDEFVVHPNDLKTLKIGECYFKTTLPS GKLFIKKIKINPTYLDGVFQKLNK |
[1] Davis RE et al (2005) Cryptic plasmid pSKU146 from the wall-less plant pathogen Spiroplasma kunkelii encodes an adhesin and components of a type IV translocation-related conjugation system. Plasmid. 53(2):179-90. [PMID:15737404] |
ID | 36 |
Plasmid name | pSKU146 |
GenBank accession number | NC_006400.1 |
Incompatibility group | IncP1 |
Genome size | 14615 bp |
Coordinate of oriT [Strand] | 377..551 [+]; 1160..1334 [+] |
Drug resistance | _ |
Heavy-metal resistance | _ |
Virulence factor | Plasmid pSKU146 harbors genes encoding putative proteins similar to known bacterial virulence factors and conjugative elements including Mob family proteins, origins of plasmid transfer, Vir domains, ICEF ORF-like proteins,and the ScARP1 adhesin of S. citri, implicating a role of pSKU146-encoded genes in conjugal cell-to-cell ommunication and pathogenesis. |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Spiroplasma kunkelii CR2-3x [273035] |
[1] Davis RE et al (2005) Cryptic plasmid pSKU146 from the wall-less plant pathogen Spiroplasma kunkelii encodes an adhesin and components of a type IV translocation-related conjugation system. Plasmid. 53(2):179-90. [PMID:15737404] |