 oriTDB accession number | 100026 |
| Name | oriT_pK214  |
Sequence Completeness  | incomplete |
| oriT length | 10 nt |
| oriT sequence | TAGTGTGTTA |
| IR (inverted repeat) | _ |
| Location of nic site | [7-8] nt |
| Conserved sequence flanking the nic site | TAGTGTG|TTA |
| Note | from GenBank |
Visualization of oriT structure Reference| [1] Hickey RM et al (2001) Exploitation of plasmid pMRC01 to direct transfer of mobilizable plasmids into commercial lactococcal starter strains. Appl Environ Microbiol. 67(6):2853-8. [PMID:11375207] |
| ID | 25 |
| Name | Mob_pK214 |
| GenBank accession number | CAA63521 |
| Family | MOBV |
| Length | 403 aa |
| UniProt ID | O32791 |
| PDB ID | _ |
| Pfam | Mob_Pre [PF01076.18], Evalue: 5.10E-77, Aligned region: 1..193 |
| Note | relaxase |
| Protein sequence [Download] | MSFAVARMQKVKSGNLVGVGNHNQRNTDNHSNKDIDVERSHLNYDLVNRTENYKRDIEQF INDNKSSSRAVRKDAVLINEWIITSDNPFFKDKDDKEIKDFFDTAKSYFADKFGDNNIRY AQVHLDETTPHMHLGIVPFNDEHKLSAKTVFNRQALQAVQDELPKYLNERGFELERGEKG SERKNLTVPEYKKAKDELKEITTTLEQRKSEVLALSNDKAPTIKKESLDLKDETKTVKVP SGETIGIGKLRHEFMKNEERKTGNVIIPESKLNAVIKSYEELYKANEKLKNYAETDLPKE ITRVKEKYRELAKDYNRLVRKSNQNIETLEELEKENKSLKNEIKGIYKGFNQFMENTLGA TVGQAKKLMNNLMSEVKEFVKGGEFEKIHRNETKTRDRDELSR |
Reference| [1] Perreten V et al (1997) Antibiotic resistance spread in food. Nature. 389(6653):801-2. [PMID:9349809] |
| [2] Hickey RM et al (2001) Exploitation of plasmid pMRC01 to direct transfer of mobilizable plasmids into commercial lactococcal starter strains. Appl Environ Microbiol. 67(6):2853-8. [PMID:11375207] |
| # | ID | Name | GenBank | Length | Note |
| 1 | 37 | _ | _ | _ | _ |
| ID | 25 |
| Plasmid name | pK214 |
| GenBank accession number | NC_009751.1 |
| Genome size | 29871 bp |
| Coordinate of oriT [Strand] | 7087..7098 [+] |
| Drug resistance | resistance to tetracyline, chloramphenicol, and streptomycin |
| Heavy-metal resistance | _ |
| Virulence factor | _ |
| Xenobiotic degradation | _ |
| Host bacterium [NCBI Taxonomy ID] | Lactococcus lactis K214 [889971] |
Reference| [1] Perreten V et al (1997) Antibiotic resistance spread in food. Nature. 389(6653):801-2. [PMID:9349809] |