[1] Meyer R (2009) The R1162 mob proteins can promote conjugative transfer from cryptic origins in the bacterial chromosome. J Bacteriol. 191(5):1574-80. [PMID:19074386] |
[2] de la Cruz F et al (2010) Conjugative DNA metabolism in Gram-negative bacteria. FEMS Microbiol Rev. 34(1):18-40. [PMID:19919603] |
[3] Brasch MA et al (1986) Genetic organization of plasmid R1162 DNA involved in conjugative mobilization. J Bacteriol. 167(2):703-10. [PMID:3525520] |
[4] Zhang S et al (1997) The relaxosome protein MobC promotes conjugal plasmid mobilization by extending DNA strand separation to the nick site at the origin of transfer. Mol Microbiol. 25(3):509-16. [PMID:9302013] |
[5] Jandle S et al (2006) Stringent and relaxed recognition of oriT by related systems for plasmid mobilization: implications for horizontal gene transfer. J Bacteriol. 188(2):499-506. [PMID:16385040] |
[6] Becker EC et al (2003) Relaxed specificity of the R1162 nickase: a model for evolution of a system for conjugative mobilization of plasmids. J Bacteriol. 185(12):3538-46. [PMID:12775691] |
[7] Parker C et al (2005) Elements in the co-evolution of relaxases and their origins of transfer. Plasmid . 53(2):113-8. [PMID:15737398] |
![]() | 8 |
![]() | MobA_R1162 ![]() |
![]() | P07112 |
![]() | MOBQ |
![]() | 709 aa |
![]() | P07112 |
![]() | 2NS6 |
![]() | |
![]() | to recognize the conserved nick region sequence |
![]() | MAIYHLTAKTGSRSGGQSARAKADYIQREGKYARDMDEVLHAESGHMPEFVERPADYWDA ADLYERANGRLFKEVEFALPVELTLDQQKALASEFAQHLTGAERLPYTLAIHAGGGENPH CHLMISERINDGIERPAAQWFKRYNGKTPEKGGAQKTEALKPKAWLEQTREAWADHANRA LERAGHDARIDHRTLEAQGIERLPGVHLGPNVVEMEGRGIRTDRADVALNIDTANAQIID LQEYREAIDHERNRQSEEIQRHQRVSGADRTAGPEHGDTGRRSPAGHEPDPAGQRGAGGG VAESPAPDRGGMGGAGQRVAGGSRRGEQRRAERPERVAGVALEAMANRDAGFHDAYGGAA DRIVALARPDATDNRGRLDLAALGGPMKNDRTLQAIGRQLKAMGCERFDIGVRDATTGQM MNREWSAAEVLQNTPWLKRMNAQGNDVYIRPAEQERHGLVLVDDLSEFDLDDMKAEGREP ALVVETSPKNYQAWVKVADAAGGELRGQIARTLASEYDADPASADSRHYGRLAGFTNRKD KHTTRAGYQPWVLLRESKGKTATAGPALVQQAGQQIEQAQRQQEKARRLASLELPERQLS RHRRTALDEYRSEMAGLVKRFGDDLSKCDFIAAQKLASRGRSAEEIGKAMAEASPALAER KPGHEADYIERTVSKVMGLPSVQLARAELARAPAPRQRGMDRGGPDFSM |
[1] Meyer R (2009) The R1162 mob proteins can promote conjugative transfer from cryptic origins in the bacterial chromosome. J Bacteriol. 191(5):1574-80. [PMID:19074386] |
[2] de la Cruz F et al (2010) Conjugative DNA metabolism in Gram-negative bacteria. FEMS Microbiol Rev. 34(1):18-40. [PMID:19919603] |
[3] Brasch MA et al (1986) Genetic organization of plasmid R1162 DNA involved in conjugative mobilization. J Bacteriol. 167(2):703-10. [PMID:3525520] |
[4] Parker C et al (2007) The R1162 relaxase/primase contains two, type IV transport signals that require the small plasmid protein MobB. Mol Microbiol. 66(1):252-61. [PMID:17880426] |
[5] Zhang S et al (1997) The relaxosome protein MobC promotes conjugal plasmid mobilization by extending DNA strand separation to the nick site at the origin of transfer. Mol Microbiol. 25(3):509-16. [PMID:9302013] |
[6] Jandle S et al (2006) Stringent and relaxed recognition of oriT by related systems for plasmid mobilization: implications for horizontal gene transfer. J Bacteriol. 188(2):499-506. [PMID:16385040] |
# | ID | Name | GenBank | Length | Note |
1 | 14 | MobB_R1162 ![]() | _ | _ | MobB_R1162 stabilizes the relaxase at oriT. R1162 encodes two small proteins required for efficient transfer: MobB (MW 15,115) and MobC (MW 10,885). |
2 | 15 | MobC_R1162 ![]() | _ | _ | R1162 encodes two small proteins required for efficient transfer: MobB (MW 15,115) and MobC (MW 10,885). |
![]() | 8 |
![]() | R1162 |
![]() | M13380.1 |
![]() | IncQ1 |
![]() | 8.9 kb |
![]() | 111..270 [+] |
![]() | ![]() |
![]() | _ |
![]() | _ |
![]() | _ |
![]() | Pseudomonas aeruginosa [287] |
[1] Barth PT et al (1974) Comparison of the deoxyribonucleic acid molecular weights and homologies of plasmids conferring linked resistance to streptomycin and sulfonamides. J Bacteriol. 120(2):618-30. [PMID:4616941] |