[1] Kurenbach B et al (2006) The TraA relaxase autoregulates the putative type IV secretion-like system encoded by the broad-host-range Streptococcus agalactiae plasmid pIP501. Microbiology. 152(Pt 3):637-45. [PMID:16514144] |
[2] Kurenbach B et al (2003) Intergeneric transfer of the Enterococcus faecalis plasmid pIP501 to Escherichia coli and Streptomyces lividans and sequence analysis of its tra region. Plasmid. 50(1):86-93. [PMID:12826062] |
[3] Wang A et al (1995) Streptococcal Plasmid pIP501 Has a Functional oriT Site. J Bacteriol. 177(15):4199-206. [PMID:7635806] |
ID | 5 |
Name | TraA_pIP501 |
GenBank accession number | AAA99466 |
Family | MOBQ |
Length | 654 aa |
UniProt ID | Q52001 |
PDB ID | _ |
Pfam | MobA_MobL [PF03389.14], Evalue: 2.10E-66, Aligned region: 11..235 |
Note | relaxase |
Protein sequence [Download] | MTIAKRENGKRSLIAMASYRSGEKLYSELYEKTNLYNHRTVKPEAFILKPDYVPNEFLDR QTLWNKMELAEKSPNAQLCREVNVALPIELNNSDQRMLIEDFVKDNFVNEGMIADVAIHR DDENNPHAHIMLTMREVDSEGNILNKSHRIPKLDENGNQIFNEKGQRVTVSIKTNDWGRK SLVSEIRKDWADKVNQYLKDRNIDQQITEKSHAELGKKELPTIHEGFYSKKLEDKGVISE LKRKNLEIQSYNDILAELDKLENQEKVLKQDQNFTLKFEKTFSPLEKGELKNLSKELKLF INDENIDKRLGELKRWENSLIFNNKMEIQKQRLMLSKISSERDMLTKANEILDKQAERFF KKSYPSLNIDKFSNHEVRAMVNETIFRKQLLNKDQLAEVIYNERVVEKEESKKIFKEKPF QTSRYLDSKIKQIEDSITKENNPERKEILSIKKEKLIGIKQGLIEYVQSEVERKFDKNVS IDSVIEGEMLLAKADYYKTTDFSKVEGVARFSSEEINSMLEQSKGFLTNIQTVKIPNDCQ GVFFVQDSMKHIDELSPLAKQNLKKVVNRNAYLPDSDKIELSKEIENTNKDQSQELDKDV PEKNEVTVKMFQFAKSINRLLSGNQLQKKRNLDKLIKQTKAKKNQSLQRNIPLR |
[1] Kurenbach B et al (2006) The TraA relaxase autoregulates the putative type IV secretion-like system encoded by the broad-host-range Streptococcus agalactiae plasmid pIP501. Microbiology. 152(Pt 3):637-45. [PMID:16514144] |
[2] Kurenbach B et al (2003) Intergeneric transfer of the Enterococcus faecalis plasmid pIP501 to Escherichia coli and Streptomyces lividans and sequence analysis of its tra region. Plasmid. 50(1):86-93. [PMID:12826062] |
# | ID | Name | GenBank | Length | Note |
1 | 10 | _ | _ | _ | _ |
ID | 5 |
Plasmid name | pIP501 |
GenBank accession number | L39769.1 |
Incompatibility group | Inc18 |
Genome size | 30.2 kb |
Coordinate of oriT [Strand] | 1259..1296 [-] |
Drug resistance | resitance to chloramphenicol and MLS (macrolide, lincosamide, streptogramin B antibiotics) |
Heavy-metal resistance | _ |
Virulence factor | _ |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Streptococcus agalactiae B-49813/75 [1311] |
[1] Horodniceanu T et al (1976) R plasmids in Streptococcus agalactiae (group B). Antimicrob Agents Chemother. 10(5):795-801. [PMID:795369] |
[2] Trieu-Cuot P et al (1992) Nucleotide sequence of the chloramphenicol resistance determinant of the streptococcal plasmid pIP501. Plasmid. 28(3):272-6. [PMID:1461942] |
[3] Gonzalez CF et al (1983) Plasmid transfer in Pediococcus spp.: intergeneric and intrageneric transfer of pIP501. Appl Environ Microbiol. 46(1):81-9. [PMID:6311098] |