![]() | 6 |
![]() | TraK_RK2 ![]() |
![]() | CAJ85729 |
![]() | 134 aa |
![]() | A6H981 |
![]() | _ |
![]() | _ |
![]() | TraK oriT binding protein |
![]() | MPKSYTDELAEWVESRAAKKRRRDEAAVAFLAVRADVEAALASGYALVTIWEHMRETGKV KFSYETFRSHARRHIKAKPADVPAPQAKAAEPAPAPKTPEPRRPKQGGKAEKPAPAAAPT GFTFNPTPDKKDLL |
[1] Zatyka M et al (1994) Location and nucleotide sequence of the transfer origin of the broad host range plasmid RK2. Microbiology. 140 ( Pt 11):2981-90. [PMID:7812437] |
[2] Waters VL et al (1991) Sequence identity in the nick regions of IncP plasmid transfer origins and T-DNA borders of Agrobacterium Ti plasmids. Proc Natl Acad Sci U S A. 88(4):1456-60. [PMID:1996345] |