![]() | 252 |
![]() | MobB_pTC-F14 ![]() |
![]() | NP_835375 |
![]() | 103 aa |
![]() | Q840R4 |
![]() | _ |
![]() | _ |
![]() | oriT recognition-like protein |
![]() | MPFTVQGLEPLDAVVNVRLTASEKARLREDADLAGLSVSELVRRRYFGRPIVAHADAVLL KELRRIGGLLKHVHNESGGAYSQQTAAVLVTLKAAIEGLSHDR |
[1] Rawlings DE (2005) The evolution of pTF-FC2 and pTC-F14, two related plasmids of the IncQ-family. Plasmid. 53(2):137-47. [PMID:15737401] |
[2] van Zyl LJ et al (2003) Analysis of the mobilization region of the broad-host-range IncQ-like plasmid pTC-F14 and its ability to interact with a related plasmid, pTF-FC2. J Bacteriol. 185(20):6104-11. [PMID:14526022] |