![]() | 244 |
![]() | TraK_R751 ![]() |
![]() | NP_044276 |
![]() | 132 aa |
![]() | _ |
![]() | _ |
![]() | _ |
![]() | _ |
![]() | MPKTYPEELAEWVKGREAKKPRQDKHVVAFLAVKSDVQAALDAGYAMKTIWEHMKETGRL RCRYETFTQHVKRYIKAAPVASPPPPATPPDSQPKGAKPEPKAAPPASESKSEPPKIGGF TFDATPKKEDLL |
[1] Waters VL et al (1991) Sequence identity in the nick regions of IncP plasmid transfer origins and T-DNA borders of Agrobacterium Ti plasmids. Proc Natl Acad Sci U S A. 88(4):1456-60. [PMID:1996345] |
[2] Pansegrau W et al (1988) The origin of conjugative IncP plasmid transfer: interaction with plasmid-encoded products and the nucleotide sequence at the relaxation site. Biochim Biophys Acta. 951(2-3):365-74. [PMID:2850014] |