![]() | 243 |
![]() | TraJ_R751 ![]() |
![]() | NP_044275 |
![]() | 124 aa |
![]() | _ |
![]() | _ |
![]() | _ |
![]() | _ |
![]() | MENDEKEHGRRRRQHLRVPVFPEEKDEIEANAKRAGVSVARYLRDVGQGYQIKGVMDYQH VRELVRVNGDLGRLGGLLKLWLTDDVRTLQFGEATILALLGRIEATQDEMSRIMKAVVQP RAEP |
[1] Waters VL et al (1991) Sequence identity in the nick regions of IncP plasmid transfer origins and T-DNA borders of Agrobacterium Ti plasmids. Proc Natl Acad Sci U S A. 88(4):1456-60. [PMID:1996345] |
[2] Pansegrau W et al (1988) The origin of conjugative IncP plasmid transfer: interaction with plasmid-encoded products and the nucleotide sequence at the relaxation site. Biochim Biophys Acta. 951(2-3):365-74. [PMID:2850014] |
[3] Fürste JP et al (1989) Conjugative transfer of promiscuous IncP plasmids: interaction of plasmid-encoded products with the transfer origin. Proc Natl Acad Sci U S A. 86(6):1771-5. [PMID:2538813] |