 ID | 13 |
| Name | TrwA_R388  |
| GenBank accession number | YP_009182121 |
| Length | 121 aa |
| UniProt ID | Q04229 |
| PDB ID | _ |
| Pfam | _ |
| Note | TrwA, together with TrwC and plasmid R388 oriT, forms a stable nucleoprotein structure, the relaxosome |
| Protein sequence [Download] | MALGDPIQVRLSPEKQALLEDEAARKGKRLATYLRELLESENDLQGELAALRREVVSLHH VIEDLADTGLRSDQSGPGQNAVQIETLLLLRAIAGPERMKPVKGELKRLGIEVWTPEGKE D |
Reference| [1] Revilla C et al (2008) Different pathways to acquiring resistance genes illustrated by the recent evolution of IncW plasmids. Antimicrob Agents Chemother. 52(4):1472-80. [PMID:18268088] |
| [2] Llosa M et al (1994) Genetic organization of the conjugal DNA processing region of the IncW plasmid R388. J Mol Biol. 235(2):448-64. [PMID:8289274] |
| [3] de la Cruz F et al (2010) Conjugative DNA metabolism in Gram-negative bacteria. FEMS Microbiol Rev. 34(1):18-40. [PMID:19919603] |
| [4] Fernández-López R et al (2006) Dynamics of the IncW genetic backbone imply general trends in conjugative plasmid evolution. FEMS Microbiol Rev. 30(6):942-66. [PMID:17026718] |