99515

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3109895..3110115 Replicon chromosome
Accession NZ_CP027577
Organism Escherichia coli strain 2013C-4225

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag C6997_RS16865 Protein ID WP_000170954.1
Coordinates 3109895..3110002 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3110052..3110115 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6997_RS16840 3105739..3106821 + 1083 WP_000804726.1 peptide chain release factor 1 -
C6997_RS16845 3106821..3107654 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
C6997_RS16850 3107651..3108043 + 393 WP_000200378.1 invasion regulator SirB2 -
C6997_RS16855 3108047..3108856 + 810 WP_001257045.1 invasion regulator SirB1 -
C6997_RS16860 3108892..3109746 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C6997_RS16865 3109895..3110002 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3110052..3110115 + 64 NuclAT_32 - Antitoxin
- 3110052..3110115 + 64 NuclAT_32 - Antitoxin
- 3110052..3110115 + 64 NuclAT_32 - Antitoxin
- 3110052..3110115 + 64 NuclAT_32 - Antitoxin
- 3110052..3110115 + 64 NuclAT_35 - Antitoxin
- 3110052..3110115 + 64 NuclAT_35 - Antitoxin
- 3110052..3110115 + 64 NuclAT_35 - Antitoxin
- 3110052..3110115 + 64 NuclAT_35 - Antitoxin
- 3110052..3110115 + 64 NuclAT_38 - Antitoxin
- 3110052..3110115 + 64 NuclAT_38 - Antitoxin
- 3110052..3110115 + 64 NuclAT_38 - Antitoxin
- 3110052..3110115 + 64 NuclAT_38 - Antitoxin
- 3110052..3110115 + 64 NuclAT_41 - Antitoxin
- 3110052..3110115 + 64 NuclAT_41 - Antitoxin
- 3110052..3110115 + 64 NuclAT_41 - Antitoxin
- 3110052..3110115 + 64 NuclAT_41 - Antitoxin
- 3110052..3110115 + 64 NuclAT_44 - Antitoxin
- 3110052..3110115 + 64 NuclAT_44 - Antitoxin
- 3110052..3110115 + 64 NuclAT_44 - Antitoxin
- 3110052..3110115 + 64 NuclAT_44 - Antitoxin
- 3110052..3110115 + 64 NuclAT_47 - Antitoxin
- 3110052..3110115 + 64 NuclAT_47 - Antitoxin
- 3110052..3110115 + 64 NuclAT_47 - Antitoxin
- 3110052..3110115 + 64 NuclAT_47 - Antitoxin
C6997_RS16870 3110430..3110537 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3110590..3110651 + 62 NuclAT_31 - -
- 3110590..3110651 + 62 NuclAT_31 - -
- 3110590..3110651 + 62 NuclAT_31 - -
- 3110590..3110651 + 62 NuclAT_31 - -
- 3110590..3110651 + 62 NuclAT_34 - -
- 3110590..3110651 + 62 NuclAT_34 - -
- 3110590..3110651 + 62 NuclAT_34 - -
- 3110590..3110651 + 62 NuclAT_34 - -
- 3110590..3110651 + 62 NuclAT_37 - -
- 3110590..3110651 + 62 NuclAT_37 - -
- 3110590..3110651 + 62 NuclAT_37 - -
- 3110590..3110651 + 62 NuclAT_37 - -
- 3110590..3110651 + 62 NuclAT_40 - -
- 3110590..3110651 + 62 NuclAT_40 - -
- 3110590..3110651 + 62 NuclAT_40 - -
- 3110590..3110651 + 62 NuclAT_40 - -
- 3110590..3110651 + 62 NuclAT_43 - -
- 3110590..3110651 + 62 NuclAT_43 - -
- 3110590..3110651 + 62 NuclAT_43 - -
- 3110590..3110651 + 62 NuclAT_43 - -
- 3110590..3110651 + 62 NuclAT_46 - -
- 3110590..3110651 + 62 NuclAT_46 - -
- 3110590..3110651 + 62 NuclAT_46 - -
- 3110590..3110651 + 62 NuclAT_46 - -
- 3110590..3110653 + 64 NuclAT_17 - -
- 3110590..3110653 + 64 NuclAT_17 - -
- 3110590..3110653 + 64 NuclAT_17 - -
- 3110590..3110653 + 64 NuclAT_17 - -
- 3110590..3110653 + 64 NuclAT_19 - -
- 3110590..3110653 + 64 NuclAT_19 - -
- 3110590..3110653 + 64 NuclAT_19 - -
- 3110590..3110653 + 64 NuclAT_19 - -
- 3110590..3110653 + 64 NuclAT_21 - -
- 3110590..3110653 + 64 NuclAT_21 - -
- 3110590..3110653 + 64 NuclAT_21 - -
- 3110590..3110653 + 64 NuclAT_21 - -
- 3110590..3110653 + 64 NuclAT_23 - -
- 3110590..3110653 + 64 NuclAT_23 - -
- 3110590..3110653 + 64 NuclAT_23 - -
- 3110590..3110653 + 64 NuclAT_23 - -
- 3110590..3110653 + 64 NuclAT_25 - -
- 3110590..3110653 + 64 NuclAT_25 - -
- 3110590..3110653 + 64 NuclAT_25 - -
- 3110590..3110653 + 64 NuclAT_25 - -
- 3110590..3110653 + 64 NuclAT_27 - -
- 3110590..3110653 + 64 NuclAT_27 - -
- 3110590..3110653 + 64 NuclAT_27 - -
- 3110590..3110653 + 64 NuclAT_27 - -
C6997_RS16880 3110966..3111073 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 3111121..3111186 + 66 NuclAT_30 - -
- 3111121..3111186 + 66 NuclAT_30 - -
- 3111121..3111186 + 66 NuclAT_30 - -
- 3111121..3111186 + 66 NuclAT_30 - -
- 3111121..3111186 + 66 NuclAT_33 - -
- 3111121..3111186 + 66 NuclAT_33 - -
- 3111121..3111186 + 66 NuclAT_33 - -
- 3111121..3111186 + 66 NuclAT_33 - -
- 3111121..3111186 + 66 NuclAT_36 - -
- 3111121..3111186 + 66 NuclAT_36 - -
- 3111121..3111186 + 66 NuclAT_36 - -
- 3111121..3111186 + 66 NuclAT_36 - -
- 3111121..3111186 + 66 NuclAT_39 - -
- 3111121..3111186 + 66 NuclAT_39 - -
- 3111121..3111186 + 66 NuclAT_39 - -
- 3111121..3111186 + 66 NuclAT_39 - -
- 3111121..3111186 + 66 NuclAT_42 - -
- 3111121..3111186 + 66 NuclAT_42 - -
- 3111121..3111186 + 66 NuclAT_42 - -
- 3111121..3111186 + 66 NuclAT_42 - -
- 3111121..3111186 + 66 NuclAT_45 - -
- 3111121..3111186 + 66 NuclAT_45 - -
- 3111121..3111186 + 66 NuclAT_45 - -
- 3111121..3111186 + 66 NuclAT_45 - -
- 3111121..3111188 + 68 NuclAT_16 - -
- 3111121..3111188 + 68 NuclAT_16 - -
- 3111121..3111188 + 68 NuclAT_16 - -
- 3111121..3111188 + 68 NuclAT_16 - -
- 3111121..3111188 + 68 NuclAT_18 - -
- 3111121..3111188 + 68 NuclAT_18 - -
- 3111121..3111188 + 68 NuclAT_18 - -
- 3111121..3111188 + 68 NuclAT_18 - -
- 3111121..3111188 + 68 NuclAT_20 - -
- 3111121..3111188 + 68 NuclAT_20 - -
- 3111121..3111188 + 68 NuclAT_20 - -
- 3111121..3111188 + 68 NuclAT_20 - -
- 3111121..3111188 + 68 NuclAT_22 - -
- 3111121..3111188 + 68 NuclAT_22 - -
- 3111121..3111188 + 68 NuclAT_22 - -
- 3111121..3111188 + 68 NuclAT_22 - -
- 3111121..3111188 + 68 NuclAT_24 - -
- 3111121..3111188 + 68 NuclAT_24 - -
- 3111121..3111188 + 68 NuclAT_24 - -
- 3111121..3111188 + 68 NuclAT_24 - -
- 3111121..3111188 + 68 NuclAT_26 - -
- 3111121..3111188 + 68 NuclAT_26 - -
- 3111121..3111188 + 68 NuclAT_26 - -
- 3111121..3111188 + 68 NuclAT_26 - -
C6997_RS16885 3111478..3112578 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
C6997_RS16890 3112848..3113078 + 231 WP_001146442.1 putative cation transport regulator ChaB -
C6997_RS16895 3113236..3113931 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
C6997_RS16900 3113975..3114328 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T99515 WP_000170954.1 NZ_CP027577:c3110002-3109895 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T99515 NZ_CP027577:c3110002-3109895 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT99515 NZ_CP027577:3110052-3110115 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References