Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 6564..6834 | Replicon | plasmid unnamed |
| Accession | NZ_CP027553 | ||
| Organism | Escherichia coli strain 2015C-4498 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | C6953_RS29230 | Protein ID | WP_001312861.1 |
| Coordinates | 6676..6834 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 6564..6627 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6953_RS30225 | 1837..2148 | + | 312 | WP_199851519.1 | hypothetical protein | - |
| C6953_RS29200 | 2378..2905 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| C6953_RS29205 | 2961..3194 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| C6953_RS29210 | 3253..5211 | + | 1959 | WP_001145473.1 | ParB/RepB/Spo0J family partition protein | - |
| C6953_RS29215 | 5266..5700 | + | 435 | WP_044804925.1 | conjugation system SOS inhibitor PsiB | - |
| C6953_RS29220 | 5697..6460 | + | 764 | Protein_7 | plasmid SOS inhibition protein A | - |
| - | 6429..6632 | + | 204 | NuclAT_0 | - | - |
| - | 6429..6632 | + | 204 | NuclAT_0 | - | - |
| - | 6429..6632 | + | 204 | NuclAT_0 | - | - |
| - | 6429..6632 | + | 204 | NuclAT_0 | - | - |
| - | 6564..6627 | - | 64 | - | - | Antitoxin |
| C6953_RS29230 | 6676..6834 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| C6953_RS30230 | 7524..7730 | + | 207 | WP_000547971.1 | hypothetical protein | - |
| C6953_RS29250 | 7755..8042 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| C6953_RS30235 | 8162..8245 | + | 84 | Protein_11 | DUF945 domain-containing protein | - |
| C6953_RS29260 | 8430..9617 | - | 1188 | WP_106884016.1 | IS91 family transposase | - |
| C6953_RS29265 | 9617..9982 | - | 366 | WP_000091308.1 | hypothetical protein | - |
| C6953_RS29275 | 10440..11420 | - | 981 | WP_000019402.1 | IS5-like element IS5 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hlyC / hlyA / hlyB / hlyB / hlyD / espP | 1..67055 | 67055 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T99420 WP_001312861.1 NZ_CP027553:6676-6834 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T99420 NZ_CP027553:6676-6834 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT99420 NZ_CP027553:c6627-6564 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|