Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1452766..1452991 | Replicon | chromosome |
Accession | NZ_CP027550 | ||
Organism | Escherichia coli strain 2015C-4136CT1 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | C6950_RS07890 | Protein ID | WP_000813254.1 |
Coordinates | 1452766..1452921 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1452933..1452991 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6950_RS07840 | 1448895..1449150 | - | 256 | Protein_1444 | DUF3927 family protein | - |
C6950_RS07845 | 1449147..1449575 | - | 429 | Protein_1445 | tellurite resistance TerB family protein | - |
C6950_RS07870 | 1450208..1450897 | - | 690 | WP_001064889.1 | antiterminator | - |
C6950_RS07875 | 1450894..1451259 | - | 366 | WP_021559919.1 | RusA family crossover junction endodeoxyribonuclease | - |
C6950_RS07880 | 1451260..1452318 | - | 1059 | WP_021559920.1 | DUF968 domain-containing protein | - |
C6950_RS07885 | 1452320..1452598 | - | 279 | WP_032155008.1 | hypothetical protein | - |
C6950_RS07890 | 1452766..1452921 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 1452933..1452991 | + | 59 | - | - | Antitoxin |
C6950_RS07900 | 1453621..1454064 | + | 444 | WP_021559921.1 | acetyltransferase | - |
C6950_RS07905 | 1454085..1454669 | - | 585 | WP_021559922.1 | XRE family transcriptional regulator | - |
C6950_RS07910 | 1454855..1456093 | - | 1239 | WP_021559923.1 | IS110 family transposase | - |
C6950_RS07915 | 1456409..1456831 | - | 423 | WP_021559924.1 | DUF977 family protein | - |
C6950_RS07920 | 1456872..1457954 | - | 1083 | WP_021559925.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleF / nleH2 / nleB2 | 1415134..1469964 | 54830 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T99373 WP_000813254.1 NZ_CP027550:c1452921-1452766 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T99373 NZ_CP027550:c1452921-1452766 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACTGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATTGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACTGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT99373 NZ_CP027550:1452933-1452991 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|