Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 8517..8759 | Replicon | plasmid unnamed2 |
Accession | NZ_CP027537 | ||
Organism | Escherichia coli strain AR_0081 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | AM460_RS27560 | Protein ID | WP_001312861.1 |
Coordinates | 8517..8675 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 8719..8759 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AM460_RS27515 | 3628..3855 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
AM460_RS27520 | 3943..4620 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
AM460_RS27525 | 4754..5137 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
AM460_RS27530 | 5468..6070 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
AM460_RS27535 | 6367..7188 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
AM460_RS27540 | 7308..7595 | - | 288 | WP_000107535.1 | hypothetical protein | - |
AM460_RS28605 | 7620..7826 | - | 207 | WP_000275859.1 | hypothetical protein | - |
AM460_RS28610 | 7739..8074 | - | 336 | WP_013023876.1 | hypothetical protein | - |
AM460_RS27560 | 8517..8675 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 8719..8759 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 8719..8759 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 8719..8759 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 8719..8759 | - | 41 | NuclAT_1 | - | Antitoxin |
- | 10203..10389 | - | 187 | NuclAT_0 | - | - |
- | 10203..10389 | - | 187 | NuclAT_0 | - | - |
- | 10203..10389 | - | 187 | NuclAT_0 | - | - |
- | 10203..10389 | - | 187 | NuclAT_0 | - | - |
AM460_RS27570 | 10401..11120 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
AM460_RS27575 | 11117..11551 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
AM460_RS27580 | 11606..13564 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B | - | 1..100279 | 100279 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T99226 WP_001312861.1 NZ_CP027537:c8675-8517 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T99226 NZ_CP027537:c8675-8517 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 41 bp
>AT99226 NZ_CP027537:c8759-8719 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|