Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 78744..78997 | Replicon | plasmid unnamed |
Accession | NZ_CP027458 | ||
Organism | Escherichia coli strain 88-3493 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A148HBD8 |
Locus tag | C6W79_RS26065 | Protein ID | WP_001336447.1 |
Coordinates | 78744..78893 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 78941..78997 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6W79_RS26020 | 74278..74700 | - | 423 | WP_028985400.1 | Exc2 family lipoprotein | - |
C6W79_RS26025 | 74983..75498 | + | 516 | Protein_89 | transposase | - |
C6W79_RS26030 | 75829..76068 | - | 240 | WP_000859018.1 | MarR family transcriptional regulator | - |
C6W79_RS26045 | 77044..77901 | - | 858 | WP_000130991.1 | incFII family plasmid replication initiator RepA | - |
C6W79_RS26050 | 77894..77968 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
C6W79_RS26060 | 78203..78460 | - | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
C6W79_RS26065 | 78744..78893 | - | 150 | WP_001336447.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 78941..78997 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 78941..78997 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 78941..78997 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 78941..78997 | + | 57 | NuclAT_1 | - | Antitoxin |
C6W79_RS26080 | 79657..80118 | - | 462 | WP_000760084.1 | thermonuclease family protein | - |
C6W79_RS26090 | 81214..81771 | - | 558 | WP_024213676.1 | fertility inhibition protein FinO | - |
C6W79_RS26095 | 81807..82175 | - | 369 | WP_000722534.1 | NirD/YgiW/YdeI family stress tolerance protein | - |
C6W79_RS26100 | 82258..83004 | - | 747 | WP_024213675.1 | type-F conjugative transfer system pilin acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | hlyD / hlyB / hlyA / hlyC | 1..107796 | 107796 | |
- | flank | IS/Tn | - | - | 75096..75530 | 434 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T99022 WP_001336447.1 NZ_CP027458:c78893-78744 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T99022 NZ_CP027458:c78893-78744 [Escherichia coli]
ATGACGAAATATACCCTTATTGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATACCCTTATTGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT99022 NZ_CP027458:78941-78997 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|