Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 47133..47386 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP027455 | ||
| Organism | Escherichia coli strain 2014C-4423 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | C6W74_RS28830 | Protein ID | WP_001312851.1 |
| Coordinates | 47133..47282 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 47327..47386 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6W74_RS28770 | 42360..42950 | + | 591 | WP_021553172.1 | hypothetical protein | - |
| C6W74_RS28775 | 42968..43315 | - | 348 | WP_000142451.1 | hypothetical protein | - |
| C6W74_RS28785 | 43667..43858 | - | 192 | WP_021553171.1 | hypothetical protein | - |
| C6W74_RS28790 | 43965..44240 | - | 276 | WP_000421257.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| C6W74_RS28795 | 44240..44524 | - | 285 | WP_024223171.1 | ribbon-helix-helix domain-containing protein | - |
| C6W74_RS28810 | 45434..46291 | - | 858 | WP_021569951.1 | incFII family plasmid replication initiator RepA | - |
| C6W74_RS28815 | 46284..46358 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| C6W74_RS28825 | 46592..46849 | - | 258 | WP_021553168.1 | replication regulatory protein RepA | - |
| C6W74_RS28830 | 47133..47282 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 47327..47386 | + | 60 | NuclAT_1 | - | Antitoxin |
| - | 47327..47386 | + | 60 | NuclAT_1 | - | Antitoxin |
| - | 47327..47386 | + | 60 | NuclAT_1 | - | Antitoxin |
| - | 47327..47386 | + | 60 | NuclAT_1 | - | Antitoxin |
| C6W74_RS28840 | 47529..48002 | - | 474 | WP_021553167.1 | hypothetical protein | - |
| C6W74_RS28845 | 48157..48750 | - | 594 | WP_021553166.1 | DUF2726 domain-containing protein | - |
| C6W74_RS28850 | 48788..48997 | - | 210 | WP_001333231.1 | hemolysin expression modulator Hha | - |
| C6W74_RS28855 | 49043..49504 | - | 462 | WP_021553165.1 | thermonuclease family protein | - |
| C6W74_RS29845 | 49506..50459 | - | 954 | Protein_76 | YadA-like family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..73262 | 73262 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T98993 WP_001312851.1 NZ_CP027455:c47282-47133 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T98993 NZ_CP027455:c47282-47133 [Escherichia coli]
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT98993 NZ_CP027455:47327-47386 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|