Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2277965..2278186 | Replicon | chromosome |
| Accession | NZ_CP027452 | ||
| Organism | Escherichia coli strain 2014C-3338 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | C6W71_RS11770 | Protein ID | WP_001295224.1 |
| Coordinates | 2278079..2278186 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2277965..2278030 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6W71_RS11745 | 2273406..2274308 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| C6W71_RS11750 | 2274319..2275302 | + | 984 | WP_106889440.1 | dipeptide ABC transporter ATP-binding protein | - |
| C6W71_RS11755 | 2275299..2276303 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| C6W71_RS11760 | 2276333..2277604 | - | 1272 | WP_001318103.1 | amino acid permease | - |
| - | 2277965..2278030 | - | 66 | - | - | Antitoxin |
| C6W71_RS11770 | 2278079..2278186 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| C6W71_RS11775 | 2278273..2279952 | - | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
| C6W71_RS11780 | 2279949..2280140 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| C6W71_RS11785 | 2280137..2281708 | - | 1572 | WP_001204944.1 | cellulose biosynthesis protein BcsE | - |
| C6W71_RS11790 | 2281981..2282169 | + | 189 | WP_001063315.1 | YhjR family protein | - |
| C6W71_RS11795 | 2282181..2282933 | + | 753 | WP_000279544.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T98937 WP_001295224.1 NZ_CP027452:2278079-2278186 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T98937 NZ_CP027452:2278079-2278186 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT98937 NZ_CP027452:c2278030-2277965 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|