Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-orzP/Ldr(toxin) |
Location | 515535..515756 | Replicon | chromosome |
Accession | NZ_CP027447 | ||
Organism | Escherichia coli strain 2014C-3075 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | - |
Locus tag | C6W72_RS02745 | Protein ID | WP_096986794.1 |
Coordinates | 515535..515642 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | orzP | ||
Locus tag | - | ||
Coordinates | 515690..515756 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6W72_RS02720 | 511379..512461 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
C6W72_RS02725 | 512461..513294 | + | 834 | WP_000456446.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
C6W72_RS02730 | 513291..513683 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
C6W72_RS02735 | 513687..514496 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
C6W72_RS02740 | 514532..515386 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
C6W72_RS02745 | 515535..515642 | - | 108 | WP_096986794.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 515690..515756 | + | 67 | NuclAT_12 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_12 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_12 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_12 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_13 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_13 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_13 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_13 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_14 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_14 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_14 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_14 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_15 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_15 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_15 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_15 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_16 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_16 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_16 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_16 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_17 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_17 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_17 | - | Antitoxin |
- | 515690..515756 | + | 67 | NuclAT_17 | - | Antitoxin |
- | 515692..515755 | + | 64 | NuclAT_18 | - | - |
- | 515692..515755 | + | 64 | NuclAT_18 | - | - |
- | 515692..515755 | + | 64 | NuclAT_18 | - | - |
- | 515692..515755 | + | 64 | NuclAT_18 | - | - |
- | 515692..515755 | + | 64 | NuclAT_19 | - | - |
- | 515692..515755 | + | 64 | NuclAT_19 | - | - |
- | 515692..515755 | + | 64 | NuclAT_19 | - | - |
- | 515692..515755 | + | 64 | NuclAT_19 | - | - |
- | 515692..515755 | + | 64 | NuclAT_20 | - | - |
- | 515692..515755 | + | 64 | NuclAT_20 | - | - |
- | 515692..515755 | + | 64 | NuclAT_20 | - | - |
- | 515692..515755 | + | 64 | NuclAT_20 | - | - |
- | 515692..515755 | + | 64 | NuclAT_21 | - | - |
- | 515692..515755 | + | 64 | NuclAT_21 | - | - |
- | 515692..515755 | + | 64 | NuclAT_21 | - | - |
- | 515692..515755 | + | 64 | NuclAT_21 | - | - |
- | 515692..515755 | + | 64 | NuclAT_22 | - | - |
- | 515692..515755 | + | 64 | NuclAT_22 | - | - |
- | 515692..515755 | + | 64 | NuclAT_22 | - | - |
- | 515692..515755 | + | 64 | NuclAT_22 | - | - |
- | 515692..515755 | + | 64 | NuclAT_23 | - | - |
- | 515692..515755 | + | 64 | NuclAT_23 | - | - |
- | 515692..515755 | + | 64 | NuclAT_23 | - | - |
- | 515692..515755 | + | 64 | NuclAT_23 | - | - |
- | 515692..515757 | + | 66 | NuclAT_26 | - | - |
- | 515692..515757 | + | 66 | NuclAT_26 | - | - |
- | 515692..515757 | + | 66 | NuclAT_26 | - | - |
- | 515692..515757 | + | 66 | NuclAT_26 | - | - |
- | 515692..515757 | + | 66 | NuclAT_27 | - | - |
- | 515692..515757 | + | 66 | NuclAT_27 | - | - |
- | 515692..515757 | + | 66 | NuclAT_27 | - | - |
- | 515692..515757 | + | 66 | NuclAT_27 | - | - |
- | 515692..515757 | + | 66 | NuclAT_28 | - | - |
- | 515692..515757 | + | 66 | NuclAT_28 | - | - |
- | 515692..515757 | + | 66 | NuclAT_28 | - | - |
- | 515692..515757 | + | 66 | NuclAT_28 | - | - |
C6W72_RS02750 | 516047..517147 | - | 1101 | WP_001301956.1 | sodium-potassium/proton antiporter ChaA | - |
C6W72_RS02755 | 517417..517647 | + | 231 | WP_096986789.1 | putative cation transport regulator ChaB | - |
C6W72_RS02760 | 517805..518500 | + | 696 | WP_096986790.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
C6W72_RS02765 | 518544..518897 | - | 354 | WP_001169670.1 | DsrE/F sulfur relay family protein YchN | - |
C6W72_RS02770 | 519082..520476 | + | 1395 | WP_096986791.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4057.83 Da Isoelectric Point: 10.4338
>T98865 WP_096986794.1 NZ_CP027447:c515642-515535 [Escherichia coli]
MTLTQFAMTFWYDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWYDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T98865 NZ_CP027447:c515642-515535 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGTACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGTACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT98865 NZ_CP027447:515690-515756 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|