Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-orzP/Ldr(toxin)
Location 515535..515756 Replicon chromosome
Accession NZ_CP027447
Organism Escherichia coli strain 2014C-3075

Toxin (Protein)


Gene name ldrD Uniprot ID -
Locus tag C6W72_RS02745 Protein ID WP_096986794.1
Coordinates 515535..515642 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name orzP
Locus tag -
Coordinates 515690..515756 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6W72_RS02720 511379..512461 + 1083 WP_000804726.1 peptide chain release factor 1 -
C6W72_RS02725 512461..513294 + 834 WP_000456446.1 peptide chain release factor N(5)-glutamine methyltransferase -
C6W72_RS02730 513291..513683 + 393 WP_000200374.1 invasion regulator SirB2 -
C6W72_RS02735 513687..514496 + 810 WP_001257044.1 invasion regulator SirB1 -
C6W72_RS02740 514532..515386 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C6W72_RS02745 515535..515642 - 108 WP_096986794.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 515690..515756 + 67 NuclAT_12 - Antitoxin
- 515690..515756 + 67 NuclAT_12 - Antitoxin
- 515690..515756 + 67 NuclAT_12 - Antitoxin
- 515690..515756 + 67 NuclAT_12 - Antitoxin
- 515690..515756 + 67 NuclAT_13 - Antitoxin
- 515690..515756 + 67 NuclAT_13 - Antitoxin
- 515690..515756 + 67 NuclAT_13 - Antitoxin
- 515690..515756 + 67 NuclAT_13 - Antitoxin
- 515690..515756 + 67 NuclAT_14 - Antitoxin
- 515690..515756 + 67 NuclAT_14 - Antitoxin
- 515690..515756 + 67 NuclAT_14 - Antitoxin
- 515690..515756 + 67 NuclAT_14 - Antitoxin
- 515690..515756 + 67 NuclAT_15 - Antitoxin
- 515690..515756 + 67 NuclAT_15 - Antitoxin
- 515690..515756 + 67 NuclAT_15 - Antitoxin
- 515690..515756 + 67 NuclAT_15 - Antitoxin
- 515690..515756 + 67 NuclAT_16 - Antitoxin
- 515690..515756 + 67 NuclAT_16 - Antitoxin
- 515690..515756 + 67 NuclAT_16 - Antitoxin
- 515690..515756 + 67 NuclAT_16 - Antitoxin
- 515690..515756 + 67 NuclAT_17 - Antitoxin
- 515690..515756 + 67 NuclAT_17 - Antitoxin
- 515690..515756 + 67 NuclAT_17 - Antitoxin
- 515690..515756 + 67 NuclAT_17 - Antitoxin
- 515692..515755 + 64 NuclAT_18 - -
- 515692..515755 + 64 NuclAT_18 - -
- 515692..515755 + 64 NuclAT_18 - -
- 515692..515755 + 64 NuclAT_18 - -
- 515692..515755 + 64 NuclAT_19 - -
- 515692..515755 + 64 NuclAT_19 - -
- 515692..515755 + 64 NuclAT_19 - -
- 515692..515755 + 64 NuclAT_19 - -
- 515692..515755 + 64 NuclAT_20 - -
- 515692..515755 + 64 NuclAT_20 - -
- 515692..515755 + 64 NuclAT_20 - -
- 515692..515755 + 64 NuclAT_20 - -
- 515692..515755 + 64 NuclAT_21 - -
- 515692..515755 + 64 NuclAT_21 - -
- 515692..515755 + 64 NuclAT_21 - -
- 515692..515755 + 64 NuclAT_21 - -
- 515692..515755 + 64 NuclAT_22 - -
- 515692..515755 + 64 NuclAT_22 - -
- 515692..515755 + 64 NuclAT_22 - -
- 515692..515755 + 64 NuclAT_22 - -
- 515692..515755 + 64 NuclAT_23 - -
- 515692..515755 + 64 NuclAT_23 - -
- 515692..515755 + 64 NuclAT_23 - -
- 515692..515755 + 64 NuclAT_23 - -
- 515692..515757 + 66 NuclAT_26 - -
- 515692..515757 + 66 NuclAT_26 - -
- 515692..515757 + 66 NuclAT_26 - -
- 515692..515757 + 66 NuclAT_26 - -
- 515692..515757 + 66 NuclAT_27 - -
- 515692..515757 + 66 NuclAT_27 - -
- 515692..515757 + 66 NuclAT_27 - -
- 515692..515757 + 66 NuclAT_27 - -
- 515692..515757 + 66 NuclAT_28 - -
- 515692..515757 + 66 NuclAT_28 - -
- 515692..515757 + 66 NuclAT_28 - -
- 515692..515757 + 66 NuclAT_28 - -
C6W72_RS02750 516047..517147 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
C6W72_RS02755 517417..517647 + 231 WP_096986789.1 putative cation transport regulator ChaB -
C6W72_RS02760 517805..518500 + 696 WP_096986790.1 glutathione-specific gamma-glutamylcyclotransferase -
C6W72_RS02765 518544..518897 - 354 WP_001169670.1 DsrE/F sulfur relay family protein YchN -
C6W72_RS02770 519082..520476 + 1395 WP_096986791.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4057.83 Da        Isoelectric Point: 10.4338

>T98865 WP_096986794.1 NZ_CP027447:c515642-515535 [Escherichia coli]
MTLTQFAMTFWYDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T98865 NZ_CP027447:c515642-515535 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGTACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT98865 NZ_CP027447:515690-515756 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References