Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 38953..39223 | Replicon | plasmid unnamed2 |
Accession | NZ_CP027439 | ||
Organism | Escherichia coli strain 2012C-4221 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | C6W65_RS26240 | Protein ID | WP_001312861.1 |
Coordinates | 39065..39223 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 38953..39016 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6W65_RS26195 | 33965..34427 | - | 463 | Protein_41 | hypothetical protein | - |
C6W65_RS27090 | 34497..34703 | + | 207 | WP_000275848.1 | hypothetical protein | - |
C6W65_RS26210 | 34729..35262 | + | 534 | WP_106907088.1 | single-stranded DNA-binding protein | - |
C6W65_RS26215 | 35325..35558 | + | 234 | WP_021564200.1 | DUF905 family protein | - |
C6W65_RS26220 | 35622..37580 | + | 1959 | WP_106907090.1 | ParB/RepB/Spo0J family partition protein | - |
C6W65_RS26225 | 37635..38069 | + | 435 | WP_000845926.1 | conjugation system SOS inhibitor PsiB | - |
C6W65_RS26230 | 38066..38785 | + | 720 | WP_106907092.1 | plasmid SOS inhibition protein A | - |
- | 38797..39021 | + | 225 | NuclAT_0 | - | - |
- | 38797..39021 | + | 225 | NuclAT_0 | - | - |
- | 38797..39021 | + | 225 | NuclAT_0 | - | - |
- | 38797..39021 | + | 225 | NuclAT_0 | - | - |
- | 38953..39016 | - | 64 | - | - | Antitoxin |
C6W65_RS26240 | 39065..39223 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C6W65_RS27095 | 39577..39789 | - | 213 | WP_162491396.1 | hypothetical protein | - |
C6W65_RS26260 | 40138..40425 | + | 288 | WP_000107538.1 | hypothetical protein | - |
C6W65_RS26265 | 40543..41364 | + | 822 | WP_158709101.1 | DUF945 domain-containing protein | - |
C6W65_RS26270 | 41661..42251 | - | 591 | WP_168926342.1 | transglycosylase SLT domain-containing protein | - |
C6W65_RS26275 | 42540..42923 | + | 384 | WP_046788507.1 | relaxosome protein TraM | - |
C6W65_RS26280 | 43110..43799 | + | 690 | WP_000283380.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | acrB / vat | 1..107188 | 107188 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T98776 WP_001312861.1 NZ_CP027439:39065-39223 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T98776 NZ_CP027439:39065-39223 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT98776 NZ_CP027439:c39016-38953 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|