Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 87584..87848 | Replicon | plasmid unnamed1 |
Accession | NZ_CP027395 | ||
Organism | Escherichia coli O104:H4 strain FDAARGOS_349 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | CEQ27_RS29015 | Protein ID | WP_001387489.1 |
Coordinates | 87696..87848 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 87584..87646 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CEQ27_RS29000 | 83686..84756 | - | 1071 | WP_000151588.1 | IncI1-type conjugal transfer protein TrbB | - |
CEQ27_RS29005 | 84775..85983 | - | 1209 | WP_000121263.1 | IncI1-type conjugal transfer protein TrbA | - |
CEQ27_RS29010 | 86290..87381 | - | 1092 | WP_000426061.1 | hypothetical protein | - |
- | 87584..87646 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 87584..87646 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 87584..87646 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 87584..87646 | - | 63 | NuclAT_0 | - | Antitoxin |
CEQ27_RS29015 | 87696..87848 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
CEQ27_RS29020 | 87920..88171 | - | 252 | WP_001291964.1 | hypothetical protein | - |
CEQ27_RS29025 | 88471..88767 | + | 297 | WP_001275298.1 | hypothetical protein | - |
CEQ27_RS30085 | 88832..89008 | - | 177 | WP_001054898.1 | hypothetical protein | - |
CEQ27_RS29030 | 89188..89397 | - | 210 | WP_001140543.1 | hemolysin expression modulator Hha | - |
CEQ27_RS29035 | 89495..90109 | - | 615 | WP_000578648.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
CEQ27_RS29040 | 90185..92352 | - | 2168 | Protein_97 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-15 / blaTEM-1B | - | 1..117229 | 117229 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T98625 WP_001387489.1 NZ_CP027395:87696-87848 [Escherichia coli O104:H4]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T98625 NZ_CP027395:87696-87848 [Escherichia coli O104:H4]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT98625 NZ_CP027395:c87646-87584 [Escherichia coli O104:H4]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|