Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1501973..1502193 | Replicon | chromosome |
| Accession | NZ_CP027390 | ||
| Organism | Escherichia coli strain 2015C-4944 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | AX062_RS08890 | Protein ID | WP_000170954.1 |
| Coordinates | 1501973..1502080 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1502130..1502193 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AX062_RS08865 | 1497817..1498899 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| AX062_RS08870 | 1498899..1499732 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| AX062_RS08875 | 1499729..1500121 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| AX062_RS08880 | 1500125..1500934 | + | 810 | WP_001257045.1 | invasion regulator SirB1 | - |
| AX062_RS08885 | 1500970..1501824 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| AX062_RS08890 | 1501973..1502080 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1502130..1502193 | + | 64 | NuclAT_32 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_32 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_32 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_32 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_35 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_35 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_35 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_35 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_38 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_38 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_38 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_38 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_41 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_41 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_41 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_41 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_44 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_44 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_44 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_44 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_47 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_47 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_47 | - | Antitoxin |
| - | 1502130..1502193 | + | 64 | NuclAT_47 | - | Antitoxin |
| AX062_RS08895 | 1502508..1502615 | - | 108 | WP_000170959.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1502668..1502729 | + | 62 | NuclAT_31 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_31 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_31 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_31 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_34 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_34 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_34 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_34 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_37 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_37 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_37 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_37 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_40 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_40 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_40 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_40 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_43 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_43 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_43 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_43 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_46 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_46 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_46 | - | - |
| - | 1502668..1502729 | + | 62 | NuclAT_46 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_17 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_17 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_17 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_17 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_19 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_19 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_19 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_19 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_21 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_21 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_21 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_21 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_23 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_23 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_23 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_23 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_25 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_25 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_25 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_25 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_27 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_27 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_27 | - | - |
| - | 1502668..1502731 | + | 64 | NuclAT_27 | - | - |
| AX062_RS08905 | 1503044..1503151 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1503199..1503264 | + | 66 | NuclAT_30 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_30 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_30 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_30 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_33 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_33 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_33 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_33 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_36 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_36 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_36 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_36 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_39 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_39 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_39 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_39 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_42 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_42 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_42 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_42 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_45 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_45 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_45 | - | - |
| - | 1503199..1503264 | + | 66 | NuclAT_45 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_16 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_16 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_16 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_16 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_18 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_18 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_18 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_18 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_20 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_20 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_20 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_20 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_22 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_22 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_22 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_22 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_24 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_24 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_24 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_24 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_26 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_26 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_26 | - | - |
| - | 1503199..1503266 | + | 68 | NuclAT_26 | - | - |
| AX062_RS08910 | 1503556..1504656 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| AX062_RS08915 | 1504926..1505156 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| AX062_RS08920 | 1505314..1506009 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| AX062_RS08925 | 1506053..1506406 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T98576 WP_000170954.1 NZ_CP027390:c1502080-1501973 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T98576 NZ_CP027390:c1502080-1501973 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 64 bp
>AT98576 NZ_CP027390:1502130-1502193 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|