Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 785762..785982 Replicon chromosome
Accession NZ_CP027388
Organism Escherichia coli strain 2011C-4251

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag C6P70_RS04465 Protein ID WP_000170965.1
Coordinates 785762..785869 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 785916..785982 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6P70_RS04430 781617..782450 + 834 WP_000456459.1 peptide chain release factor N(5)-glutamine methyltransferase -
C6P70_RS04435 782447..782839 + 393 WP_000200392.1 invasion regulator SirB2 -
C6P70_RS04440 782843..783652 + 810 WP_001257044.1 invasion regulator SirB1 -
C6P70_RS04445 783688..784542 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C6P70_RS04450 784691..784798 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 784846..784912 + 67 NuclAT_40 - -
- 784846..784912 + 67 NuclAT_40 - -
- 784846..784912 + 67 NuclAT_40 - -
- 784846..784912 + 67 NuclAT_40 - -
- 784846..784912 + 67 NuclAT_43 - -
- 784846..784912 + 67 NuclAT_43 - -
- 784846..784912 + 67 NuclAT_43 - -
- 784846..784912 + 67 NuclAT_43 - -
- 784848..784911 + 64 NuclAT_17 - -
- 784848..784911 + 64 NuclAT_17 - -
- 784848..784911 + 64 NuclAT_17 - -
- 784848..784911 + 64 NuclAT_17 - -
- 784848..784911 + 64 NuclAT_20 - -
- 784848..784911 + 64 NuclAT_20 - -
- 784848..784911 + 64 NuclAT_20 - -
- 784848..784911 + 64 NuclAT_20 - -
- 784848..784911 + 64 NuclAT_23 - -
- 784848..784911 + 64 NuclAT_23 - -
- 784848..784911 + 64 NuclAT_23 - -
- 784848..784911 + 64 NuclAT_23 - -
- 784848..784911 + 64 NuclAT_26 - -
- 784848..784911 + 64 NuclAT_26 - -
- 784848..784911 + 64 NuclAT_26 - -
- 784848..784911 + 64 NuclAT_26 - -
- 784848..784911 + 64 NuclAT_29 - -
- 784848..784911 + 64 NuclAT_29 - -
- 784848..784911 + 64 NuclAT_29 - -
- 784848..784911 + 64 NuclAT_29 - -
- 784848..784911 + 64 NuclAT_32 - -
- 784848..784911 + 64 NuclAT_32 - -
- 784848..784911 + 64 NuclAT_32 - -
- 784848..784911 + 64 NuclAT_32 - -
C6P70_RS04455 785226..785333 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 785386..785447 + 62 NuclAT_18 - -
- 785386..785447 + 62 NuclAT_18 - -
- 785386..785447 + 62 NuclAT_18 - -
- 785386..785447 + 62 NuclAT_18 - -
- 785386..785447 + 62 NuclAT_21 - -
- 785386..785447 + 62 NuclAT_21 - -
- 785386..785447 + 62 NuclAT_21 - -
- 785386..785447 + 62 NuclAT_21 - -
- 785386..785447 + 62 NuclAT_24 - -
- 785386..785447 + 62 NuclAT_24 - -
- 785386..785447 + 62 NuclAT_24 - -
- 785386..785447 + 62 NuclAT_24 - -
- 785386..785447 + 62 NuclAT_27 - -
- 785386..785447 + 62 NuclAT_27 - -
- 785386..785447 + 62 NuclAT_27 - -
- 785386..785447 + 62 NuclAT_27 - -
- 785386..785447 + 62 NuclAT_30 - -
- 785386..785447 + 62 NuclAT_30 - -
- 785386..785447 + 62 NuclAT_30 - -
- 785386..785447 + 62 NuclAT_30 - -
- 785386..785447 + 62 NuclAT_33 - -
- 785386..785447 + 62 NuclAT_33 - -
- 785386..785447 + 62 NuclAT_33 - -
- 785386..785447 + 62 NuclAT_33 - -
- 785386..785448 + 63 NuclAT_42 - -
- 785386..785448 + 63 NuclAT_42 - -
- 785386..785448 + 63 NuclAT_42 - -
- 785386..785448 + 63 NuclAT_42 - -
- 785386..785448 + 63 NuclAT_45 - -
- 785386..785448 + 63 NuclAT_45 - -
- 785386..785448 + 63 NuclAT_45 - -
- 785386..785448 + 63 NuclAT_45 - -
C6P70_RS04465 785762..785869 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 785916..785982 + 67 - - Antitoxin
C6P70_RS04470 786274..787374 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
C6P70_RS04475 787644..787874 + 231 WP_001146442.1 putative cation transport regulator ChaB -
C6P70_RS04480 788032..788727 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
C6P70_RS04485 788771..789124 - 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -
C6P70_RS04490 789309..790703 + 1395 WP_000086212.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T98528 WP_000170965.1 NZ_CP027388:c785869-785762 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T98528 NZ_CP027388:c785869-785762 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT98528 NZ_CP027388:785916-785982 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References