Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 785226..785447 Replicon chromosome
Accession NZ_CP027388
Organism Escherichia coli strain 2011C-4251

Toxin (Protein)


Gene name ldrD Uniprot ID E0IV43
Locus tag C6P70_RS04455 Protein ID WP_000170926.1
Coordinates 785226..785333 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 785386..785447 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6P70_RS04425 780535..781617 + 1083 WP_000804726.1 peptide chain release factor 1 -
C6P70_RS04430 781617..782450 + 834 WP_000456459.1 peptide chain release factor N(5)-glutamine methyltransferase -
C6P70_RS04435 782447..782839 + 393 WP_000200392.1 invasion regulator SirB2 -
C6P70_RS04440 782843..783652 + 810 WP_001257044.1 invasion regulator SirB1 -
C6P70_RS04445 783688..784542 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C6P70_RS04450 784691..784798 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 784846..784912 + 67 NuclAT_40 - -
- 784846..784912 + 67 NuclAT_40 - -
- 784846..784912 + 67 NuclAT_40 - -
- 784846..784912 + 67 NuclAT_40 - -
- 784846..784912 + 67 NuclAT_43 - -
- 784846..784912 + 67 NuclAT_43 - -
- 784846..784912 + 67 NuclAT_43 - -
- 784846..784912 + 67 NuclAT_43 - -
- 784848..784911 + 64 NuclAT_17 - -
- 784848..784911 + 64 NuclAT_17 - -
- 784848..784911 + 64 NuclAT_17 - -
- 784848..784911 + 64 NuclAT_17 - -
- 784848..784911 + 64 NuclAT_20 - -
- 784848..784911 + 64 NuclAT_20 - -
- 784848..784911 + 64 NuclAT_20 - -
- 784848..784911 + 64 NuclAT_20 - -
- 784848..784911 + 64 NuclAT_23 - -
- 784848..784911 + 64 NuclAT_23 - -
- 784848..784911 + 64 NuclAT_23 - -
- 784848..784911 + 64 NuclAT_23 - -
- 784848..784911 + 64 NuclAT_26 - -
- 784848..784911 + 64 NuclAT_26 - -
- 784848..784911 + 64 NuclAT_26 - -
- 784848..784911 + 64 NuclAT_26 - -
- 784848..784911 + 64 NuclAT_29 - -
- 784848..784911 + 64 NuclAT_29 - -
- 784848..784911 + 64 NuclAT_29 - -
- 784848..784911 + 64 NuclAT_29 - -
- 784848..784911 + 64 NuclAT_32 - -
- 784848..784911 + 64 NuclAT_32 - -
- 784848..784911 + 64 NuclAT_32 - -
- 784848..784911 + 64 NuclAT_32 - -
C6P70_RS04455 785226..785333 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 785386..785447 + 62 NuclAT_18 - Antitoxin
- 785386..785447 + 62 NuclAT_18 - Antitoxin
- 785386..785447 + 62 NuclAT_18 - Antitoxin
- 785386..785447 + 62 NuclAT_18 - Antitoxin
- 785386..785447 + 62 NuclAT_21 - Antitoxin
- 785386..785447 + 62 NuclAT_21 - Antitoxin
- 785386..785447 + 62 NuclAT_21 - Antitoxin
- 785386..785447 + 62 NuclAT_21 - Antitoxin
- 785386..785447 + 62 NuclAT_24 - Antitoxin
- 785386..785447 + 62 NuclAT_24 - Antitoxin
- 785386..785447 + 62 NuclAT_24 - Antitoxin
- 785386..785447 + 62 NuclAT_24 - Antitoxin
- 785386..785447 + 62 NuclAT_27 - Antitoxin
- 785386..785447 + 62 NuclAT_27 - Antitoxin
- 785386..785447 + 62 NuclAT_27 - Antitoxin
- 785386..785447 + 62 NuclAT_27 - Antitoxin
- 785386..785447 + 62 NuclAT_30 - Antitoxin
- 785386..785447 + 62 NuclAT_30 - Antitoxin
- 785386..785447 + 62 NuclAT_30 - Antitoxin
- 785386..785447 + 62 NuclAT_30 - Antitoxin
- 785386..785447 + 62 NuclAT_33 - Antitoxin
- 785386..785447 + 62 NuclAT_33 - Antitoxin
- 785386..785447 + 62 NuclAT_33 - Antitoxin
- 785386..785447 + 62 NuclAT_33 - Antitoxin
- 785386..785448 + 63 NuclAT_42 - -
- 785386..785448 + 63 NuclAT_42 - -
- 785386..785448 + 63 NuclAT_42 - -
- 785386..785448 + 63 NuclAT_42 - -
- 785386..785448 + 63 NuclAT_45 - -
- 785386..785448 + 63 NuclAT_45 - -
- 785386..785448 + 63 NuclAT_45 - -
- 785386..785448 + 63 NuclAT_45 - -
C6P70_RS04465 785762..785869 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 785917..785982 + 66 NuclAT_16 - -
- 785917..785982 + 66 NuclAT_16 - -
- 785917..785982 + 66 NuclAT_16 - -
- 785917..785982 + 66 NuclAT_16 - -
- 785917..785982 + 66 NuclAT_19 - -
- 785917..785982 + 66 NuclAT_19 - -
- 785917..785982 + 66 NuclAT_19 - -
- 785917..785982 + 66 NuclAT_19 - -
- 785917..785982 + 66 NuclAT_22 - -
- 785917..785982 + 66 NuclAT_22 - -
- 785917..785982 + 66 NuclAT_22 - -
- 785917..785982 + 66 NuclAT_22 - -
- 785917..785982 + 66 NuclAT_25 - -
- 785917..785982 + 66 NuclAT_25 - -
- 785917..785982 + 66 NuclAT_25 - -
- 785917..785982 + 66 NuclAT_25 - -
- 785917..785982 + 66 NuclAT_28 - -
- 785917..785982 + 66 NuclAT_28 - -
- 785917..785982 + 66 NuclAT_28 - -
- 785917..785982 + 66 NuclAT_28 - -
- 785917..785982 + 66 NuclAT_31 - -
- 785917..785982 + 66 NuclAT_31 - -
- 785917..785982 + 66 NuclAT_31 - -
- 785917..785982 + 66 NuclAT_31 - -
- 785917..785984 + 68 NuclAT_34 - -
- 785917..785984 + 68 NuclAT_34 - -
- 785917..785984 + 68 NuclAT_34 - -
- 785917..785984 + 68 NuclAT_34 - -
- 785917..785984 + 68 NuclAT_35 - -
- 785917..785984 + 68 NuclAT_35 - -
- 785917..785984 + 68 NuclAT_35 - -
- 785917..785984 + 68 NuclAT_35 - -
- 785917..785984 + 68 NuclAT_36 - -
- 785917..785984 + 68 NuclAT_36 - -
- 785917..785984 + 68 NuclAT_36 - -
- 785917..785984 + 68 NuclAT_36 - -
- 785917..785984 + 68 NuclAT_37 - -
- 785917..785984 + 68 NuclAT_37 - -
- 785917..785984 + 68 NuclAT_37 - -
- 785917..785984 + 68 NuclAT_37 - -
- 785917..785984 + 68 NuclAT_38 - -
- 785917..785984 + 68 NuclAT_38 - -
- 785917..785984 + 68 NuclAT_38 - -
- 785917..785984 + 68 NuclAT_38 - -
- 785917..785984 + 68 NuclAT_39 - -
- 785917..785984 + 68 NuclAT_39 - -
- 785917..785984 + 68 NuclAT_39 - -
- 785917..785984 + 68 NuclAT_39 - -
- 785918..785983 + 66 NuclAT_41 - -
- 785918..785983 + 66 NuclAT_41 - -
- 785918..785983 + 66 NuclAT_41 - -
- 785918..785983 + 66 NuclAT_41 - -
- 785918..785983 + 66 NuclAT_44 - -
- 785918..785983 + 66 NuclAT_44 - -
- 785918..785983 + 66 NuclAT_44 - -
- 785918..785983 + 66 NuclAT_44 - -
C6P70_RS04470 786274..787374 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
C6P70_RS04475 787644..787874 + 231 WP_001146442.1 putative cation transport regulator ChaB -
C6P70_RS04480 788032..788727 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
C6P70_RS04485 788771..789124 - 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.84 Da        Isoelectric Point: 11.6501

>T98524 WP_000170926.1 NZ_CP027388:c785333-785226 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T98524 NZ_CP027388:c785333-785226 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT98524 NZ_CP027388:785386-785447 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0E0Y1K9


Antitoxin

Download structure file

References