Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 98068..98321 | Replicon | plasmid unnamed2 |
Accession | NZ_CP027375 | ||
Organism | Escherichia coli strain 05-3629 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A148HBD8 |
Locus tag | C6P66_RS26715 | Protein ID | WP_001336447.1 |
Coordinates | 98068..98217 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 98265..98321 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6P66_RS26675 | 95153..95392 | - | 240 | WP_001365702.1 | MarR family transcriptional regulator | - |
C6P66_RS26680 | 95405..95665 | - | 261 | WP_072127342.1 | hypothetical protein | - |
C6P66_RS26695 | 96368..97225 | - | 858 | WP_052892418.1 | incFII family plasmid replication initiator RepA | - |
C6P66_RS26700 | 97218..97292 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
C6P66_RS26710 | 97527..97784 | - | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
C6P66_RS26715 | 98068..98217 | - | 150 | WP_001336447.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 98265..98321 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 98265..98321 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 98265..98321 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 98265..98321 | + | 57 | NuclAT_1 | - | Antitoxin |
C6P66_RS26730 | 98981..99442 | - | 462 | WP_000760084.1 | thermonuclease family protein | - |
C6P66_RS26740 | 100538..101095 | - | 558 | WP_024213676.1 | fertility inhibition protein FinO | - |
C6P66_RS26745 | 101131..101499 | - | 369 | WP_052892417.1 | NirD/YgiW/YdeI family stress tolerance protein | - |
C6P66_RS26750 | 101582..102328 | - | 747 | WP_052892416.1 | type-F conjugative transfer system pilin acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | hlyD / hlyB / hlyA / hlyC / espP | 1..118863 | 118863 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T98459 WP_001336447.1 NZ_CP027375:c98217-98068 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T98459 NZ_CP027375:c98217-98068 [Escherichia coli]
ATGACGAAATATACCCTTATTGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATACCCTTATTGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT98459 NZ_CP027375:98265-98321 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|