Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1217142..1217363 | Replicon | chromosome |
Accession | NZ_CP027368 | ||
Organism | Escherichia coli strain 2014C-3307 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1PGT3 |
Locus tag | C6P71_RS06555 | Protein ID | WP_000170954.1 |
Coordinates | 1217142..1217249 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1217297..1217363 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6P71_RS06530 | 1212986..1214068 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
C6P71_RS06535 | 1214068..1214901 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
C6P71_RS06540 | 1214898..1215290 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
C6P71_RS06545 | 1215294..1216103 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
C6P71_RS06550 | 1216139..1216993 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
C6P71_RS06555 | 1217142..1217249 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 1217297..1217363 | + | 67 | NuclAT_26 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_26 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_26 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_26 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_28 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_28 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_28 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_28 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_30 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_30 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_30 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_30 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_32 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_32 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_32 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_32 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_34 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_34 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_34 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_34 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_36 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_36 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_36 | - | Antitoxin |
- | 1217297..1217363 | + | 67 | NuclAT_36 | - | Antitoxin |
- | 1217299..1217362 | + | 64 | NuclAT_39 | - | - |
- | 1217299..1217362 | + | 64 | NuclAT_39 | - | - |
- | 1217299..1217362 | + | 64 | NuclAT_39 | - | - |
- | 1217299..1217362 | + | 64 | NuclAT_39 | - | - |
- | 1217299..1217362 | + | 64 | NuclAT_41 | - | - |
- | 1217299..1217362 | + | 64 | NuclAT_41 | - | - |
- | 1217299..1217362 | + | 64 | NuclAT_41 | - | - |
- | 1217299..1217362 | + | 64 | NuclAT_41 | - | - |
- | 1217299..1217362 | + | 64 | NuclAT_43 | - | - |
- | 1217299..1217362 | + | 64 | NuclAT_43 | - | - |
- | 1217299..1217362 | + | 64 | NuclAT_43 | - | - |
- | 1217299..1217362 | + | 64 | NuclAT_43 | - | - |
C6P71_RS06560 | 1217677..1217784 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 1217837..1217898 | + | 62 | NuclAT_38 | - | - |
- | 1217837..1217898 | + | 62 | NuclAT_38 | - | - |
- | 1217837..1217898 | + | 62 | NuclAT_38 | - | - |
- | 1217837..1217898 | + | 62 | NuclAT_38 | - | - |
- | 1217837..1217898 | + | 62 | NuclAT_40 | - | - |
- | 1217837..1217898 | + | 62 | NuclAT_40 | - | - |
- | 1217837..1217898 | + | 62 | NuclAT_40 | - | - |
- | 1217837..1217898 | + | 62 | NuclAT_40 | - | - |
- | 1217837..1217898 | + | 62 | NuclAT_42 | - | - |
- | 1217837..1217898 | + | 62 | NuclAT_42 | - | - |
- | 1217837..1217898 | + | 62 | NuclAT_42 | - | - |
- | 1217837..1217898 | + | 62 | NuclAT_42 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_27 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_27 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_27 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_27 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_29 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_29 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_29 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_29 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_31 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_31 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_31 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_31 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_33 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_33 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_33 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_33 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_35 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_35 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_35 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_35 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_37 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_37 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_37 | - | - |
- | 1217837..1217899 | + | 63 | NuclAT_37 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_15 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_15 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_15 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_15 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_17 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_17 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_17 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_17 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_19 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_19 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_19 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_19 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_21 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_21 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_21 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_21 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_23 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_23 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_23 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_23 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_25 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_25 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_25 | - | - |
- | 1217837..1217900 | + | 64 | NuclAT_25 | - | - |
C6P71_RS06570 | 1218213..1218320 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 1218368..1218435 | + | 68 | NuclAT_14 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_14 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_14 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_14 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_16 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_16 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_16 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_16 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_18 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_18 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_18 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_18 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_20 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_20 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_20 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_20 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_22 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_22 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_22 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_22 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_24 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_24 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_24 | - | - |
- | 1218368..1218435 | + | 68 | NuclAT_24 | - | - |
C6P71_RS06575 | 1218725..1219825 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
C6P71_RS06580 | 1220095..1220325 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
C6P71_RS06585 | 1220483..1221178 | + | 696 | WP_001355927.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
C6P71_RS06590 | 1221222..1221575 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T98385 WP_000170954.1 NZ_CP027368:c1217249-1217142 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T98385 NZ_CP027368:c1217249-1217142 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT98385 NZ_CP027368:1217297-1217363 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|