Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 55652..55906 | Replicon | plasmid unnamed |
Accession | NZ_CP027367 | ||
Organism | Escherichia coli strain 89-3156 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | - |
Locus tag | C6P65_RS26640 | Protein ID | WP_032211975.1 |
Coordinates | 55652..55858 (-) | Length | 69 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 55850..55906 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6P65_RS26590 | 51311..52060 | - | 750 | Protein_47 | ISKra4-like element ISEc51 family transposase | - |
C6P65_RS26595 | 52060..52398 | + | 339 | Protein_48 | Tn3 family transposase | - |
C6P65_RS26600 | 52737..52976 | - | 240 | WP_000859017.1 | MarR family transcriptional regulator | - |
C6P65_RS26605 | 52989..53249 | - | 261 | WP_077745091.1 | hypothetical protein | - |
C6P65_RS26620 | 53951..54808 | - | 858 | WP_028985876.1 | incFII family plasmid replication initiator RepA | - |
C6P65_RS26625 | 54801..54875 | - | 75 | WP_001365571.1 | RepA leader peptide Tap | - |
C6P65_RS26635 | 55111..55368 | - | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
C6P65_RS26640 | 55652..55858 | - | 207 | WP_032211975.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 55850..55906 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 55850..55906 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 55850..55906 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 55850..55906 | + | 57 | NuclAT_1 | - | Antitoxin |
C6P65_RS26650 | 56081..56464 | - | 384 | WP_028985877.1 | hypothetical protein | - |
C6P65_RS26655 | 56567..57028 | - | 462 | WP_000760076.1 | thermonuclease family protein | - |
C6P65_RS26665 | 58128..58685 | - | 558 | WP_028985878.1 | fertility inhibition protein FinO | - |
C6P65_RS26670 | 58721..59089 | - | 369 | WP_000722534.1 | NirD/YgiW/YdeI family stress tolerance protein | - |
C6P65_RS26675 | 59172..59918 | - | 747 | WP_028985879.1 | type-F conjugative transfer system pilin acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..125561 | 125561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7836.33 Da Isoelectric Point: 9.2439
>T98369 WP_032211975.1 NZ_CP027367:c55858-55652 [Escherichia coli]
MKYLNTTDCSLFLAERSKFMTKYALIGLLAVCATVLFFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFLAERSKFMTKYALIGLLAVCATVLFFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
>T98369 NZ_CP027367:c55858-55652 [Escherichia coli]
ATGAAGTACTTGAACACTACTGATTGTAGCCTCTTCCTTGCAGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTTTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGGG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGAAGTACTTGAACACTACTGATTGTAGCCTCTTCCTTGCAGAGAGGTCAAAGTTTATGACGAAATATGCCCTTATCGG
GTTGCTCGCCGTGTGCGCCACGGTGTTGTTTTTTTCACTGATATTCAGGGAACGGTTATGTGAGCTGAATATTCACAGGG
GAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT98369 NZ_CP027367:55850-55906 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|