Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3810799..3811019 Replicon chromosome
Accession NZ_CP027361
Organism Escherichia coli strain 2014C-4639

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag RR62_RS19160 Protein ID WP_000170954.1
Coordinates 3810799..3810906 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3810956..3811019 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RR62_RS19135 (3806643) 3806643..3807725 + 1083 WP_000804726.1 peptide chain release factor 1 -
RR62_RS19140 (3807725) 3807725..3808558 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
RR62_RS19145 (3808555) 3808555..3808947 + 393 WP_000200378.1 invasion regulator SirB2 -
RR62_RS19150 (3808951) 3808951..3809760 + 810 WP_001257045.1 invasion regulator SirB1 -
RR62_RS19155 (3809796) 3809796..3810650 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
RR62_RS19160 (3810799) 3810799..3810906 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (3810956) 3810956..3811019 + 64 NuclAT_32 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_32 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_32 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_32 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_35 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_35 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_35 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_35 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_38 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_38 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_38 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_38 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_41 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_41 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_41 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_41 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_44 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_44 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_44 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_44 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_47 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_47 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_47 - Antitoxin
- (3810956) 3810956..3811019 + 64 NuclAT_47 - Antitoxin
RR62_RS19165 (3811334) 3811334..3811441 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- (3811494) 3811494..3811555 + 62 NuclAT_31 - -
- (3811494) 3811494..3811555 + 62 NuclAT_31 - -
- (3811494) 3811494..3811555 + 62 NuclAT_31 - -
- (3811494) 3811494..3811555 + 62 NuclAT_31 - -
- (3811494) 3811494..3811555 + 62 NuclAT_34 - -
- (3811494) 3811494..3811555 + 62 NuclAT_34 - -
- (3811494) 3811494..3811555 + 62 NuclAT_34 - -
- (3811494) 3811494..3811555 + 62 NuclAT_34 - -
- (3811494) 3811494..3811555 + 62 NuclAT_37 - -
- (3811494) 3811494..3811555 + 62 NuclAT_37 - -
- (3811494) 3811494..3811555 + 62 NuclAT_37 - -
- (3811494) 3811494..3811555 + 62 NuclAT_37 - -
- (3811494) 3811494..3811555 + 62 NuclAT_40 - -
- (3811494) 3811494..3811555 + 62 NuclAT_40 - -
- (3811494) 3811494..3811555 + 62 NuclAT_40 - -
- (3811494) 3811494..3811555 + 62 NuclAT_40 - -
- (3811494) 3811494..3811555 + 62 NuclAT_43 - -
- (3811494) 3811494..3811555 + 62 NuclAT_43 - -
- (3811494) 3811494..3811555 + 62 NuclAT_43 - -
- (3811494) 3811494..3811555 + 62 NuclAT_43 - -
- (3811494) 3811494..3811555 + 62 NuclAT_46 - -
- (3811494) 3811494..3811555 + 62 NuclAT_46 - -
- (3811494) 3811494..3811555 + 62 NuclAT_46 - -
- (3811494) 3811494..3811555 + 62 NuclAT_46 - -
- (3811494) 3811494..3811557 + 64 NuclAT_17 - -
- (3811494) 3811494..3811557 + 64 NuclAT_17 - -
- (3811494) 3811494..3811557 + 64 NuclAT_17 - -
- (3811494) 3811494..3811557 + 64 NuclAT_17 - -
- (3811494) 3811494..3811557 + 64 NuclAT_19 - -
- (3811494) 3811494..3811557 + 64 NuclAT_19 - -
- (3811494) 3811494..3811557 + 64 NuclAT_19 - -
- (3811494) 3811494..3811557 + 64 NuclAT_19 - -
- (3811494) 3811494..3811557 + 64 NuclAT_21 - -
- (3811494) 3811494..3811557 + 64 NuclAT_21 - -
- (3811494) 3811494..3811557 + 64 NuclAT_21 - -
- (3811494) 3811494..3811557 + 64 NuclAT_21 - -
- (3811494) 3811494..3811557 + 64 NuclAT_23 - -
- (3811494) 3811494..3811557 + 64 NuclAT_23 - -
- (3811494) 3811494..3811557 + 64 NuclAT_23 - -
- (3811494) 3811494..3811557 + 64 NuclAT_23 - -
- (3811494) 3811494..3811557 + 64 NuclAT_25 - -
- (3811494) 3811494..3811557 + 64 NuclAT_25 - -
- (3811494) 3811494..3811557 + 64 NuclAT_25 - -
- (3811494) 3811494..3811557 + 64 NuclAT_25 - -
- (3811494) 3811494..3811557 + 64 NuclAT_27 - -
- (3811494) 3811494..3811557 + 64 NuclAT_27 - -
- (3811494) 3811494..3811557 + 64 NuclAT_27 - -
- (3811494) 3811494..3811557 + 64 NuclAT_27 - -
RR62_RS19170 (3811870) 3811870..3811977 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (3812025) 3812025..3812090 + 66 NuclAT_30 - -
- (3812025) 3812025..3812090 + 66 NuclAT_30 - -
- (3812025) 3812025..3812090 + 66 NuclAT_30 - -
- (3812025) 3812025..3812090 + 66 NuclAT_30 - -
- (3812025) 3812025..3812090 + 66 NuclAT_33 - -
- (3812025) 3812025..3812090 + 66 NuclAT_33 - -
- (3812025) 3812025..3812090 + 66 NuclAT_33 - -
- (3812025) 3812025..3812090 + 66 NuclAT_33 - -
- (3812025) 3812025..3812090 + 66 NuclAT_36 - -
- (3812025) 3812025..3812090 + 66 NuclAT_36 - -
- (3812025) 3812025..3812090 + 66 NuclAT_36 - -
- (3812025) 3812025..3812090 + 66 NuclAT_36 - -
- (3812025) 3812025..3812090 + 66 NuclAT_39 - -
- (3812025) 3812025..3812090 + 66 NuclAT_39 - -
- (3812025) 3812025..3812090 + 66 NuclAT_39 - -
- (3812025) 3812025..3812090 + 66 NuclAT_39 - -
- (3812025) 3812025..3812090 + 66 NuclAT_42 - -
- (3812025) 3812025..3812090 + 66 NuclAT_42 - -
- (3812025) 3812025..3812090 + 66 NuclAT_42 - -
- (3812025) 3812025..3812090 + 66 NuclAT_42 - -
- (3812025) 3812025..3812090 + 66 NuclAT_45 - -
- (3812025) 3812025..3812090 + 66 NuclAT_45 - -
- (3812025) 3812025..3812090 + 66 NuclAT_45 - -
- (3812025) 3812025..3812090 + 66 NuclAT_45 - -
- (3812025) 3812025..3812092 + 68 NuclAT_16 - -
- (3812025) 3812025..3812092 + 68 NuclAT_16 - -
- (3812025) 3812025..3812092 + 68 NuclAT_16 - -
- (3812025) 3812025..3812092 + 68 NuclAT_16 - -
- (3812025) 3812025..3812092 + 68 NuclAT_18 - -
- (3812025) 3812025..3812092 + 68 NuclAT_18 - -
- (3812025) 3812025..3812092 + 68 NuclAT_18 - -
- (3812025) 3812025..3812092 + 68 NuclAT_18 - -
- (3812025) 3812025..3812092 + 68 NuclAT_20 - -
- (3812025) 3812025..3812092 + 68 NuclAT_20 - -
- (3812025) 3812025..3812092 + 68 NuclAT_20 - -
- (3812025) 3812025..3812092 + 68 NuclAT_20 - -
- (3812025) 3812025..3812092 + 68 NuclAT_22 - -
- (3812025) 3812025..3812092 + 68 NuclAT_22 - -
- (3812025) 3812025..3812092 + 68 NuclAT_22 - -
- (3812025) 3812025..3812092 + 68 NuclAT_22 - -
- (3812025) 3812025..3812092 + 68 NuclAT_24 - -
- (3812025) 3812025..3812092 + 68 NuclAT_24 - -
- (3812025) 3812025..3812092 + 68 NuclAT_24 - -
- (3812025) 3812025..3812092 + 68 NuclAT_24 - -
- (3812025) 3812025..3812092 + 68 NuclAT_26 - -
- (3812025) 3812025..3812092 + 68 NuclAT_26 - -
- (3812025) 3812025..3812092 + 68 NuclAT_26 - -
- (3812025) 3812025..3812092 + 68 NuclAT_26 - -
RR62_RS19175 (3812382) 3812382..3813482 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
RR62_RS19180 (3813752) 3813752..3813982 + 231 WP_001146442.1 putative cation transport regulator ChaB -
RR62_RS19185 (3814140) 3814140..3814835 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
RR62_RS19190 (3814879) 3814879..3815232 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T98299 WP_000170954.1 NZ_CP027361:c3810906-3810799 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T98299 NZ_CP027361:c3810906-3810799 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT98299 NZ_CP027361:3810956-3811019 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References