Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 89701..89971 | Replicon | plasmid unnamed2 |
Accession | NZ_CP027357 | ||
Organism | Escherichia coli strain 2013C-4991 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | C6P55_RS29805 | Protein ID | WP_001312861.1 |
Coordinates | 89813..89971 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 89701..89764 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6P55_RS29760 | 84757..85023 | + | 267 | WP_072254135.1 | hypothetical protein | - |
C6P55_RS29780 | 85496..86023 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
C6P55_RS29785 | 86079..86312 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
C6P55_RS29790 | 86371..88328 | + | 1958 | Protein_90 | ParB/RepB/Spo0J family partition protein | - |
C6P55_RS29795 | 88383..88817 | + | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
C6P55_RS29800 | 88814..89533 | + | 720 | WP_001276228.1 | plasmid SOS inhibition protein A | - |
C6P55_RS31115 | 89545..89733 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 89545..89769 | + | 225 | NuclAT_0 | - | - |
- | 89545..89769 | + | 225 | NuclAT_0 | - | - |
- | 89545..89769 | + | 225 | NuclAT_0 | - | - |
- | 89545..89769 | + | 225 | NuclAT_0 | - | - |
- | 89701..89764 | - | 64 | - | - | Antitoxin |
C6P55_RS29805 | 89813..89971 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C6P55_RS29825 | 90892..91179 | + | 288 | WP_106912715.1 | hypothetical protein | - |
C6P55_RS29830 | 91299..92119 | + | 821 | Protein_96 | DUF932 domain-containing protein | - |
C6P55_RS29835 | 92415..93017 | - | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
C6P55_RS29840 | 93338..93721 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
C6P55_RS29845 | 93908..94597 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / sitABCD | iroB / iroC / iroD / iroE / iroN / iroN | 1..131463 | 131463 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T98279 WP_001312861.1 NZ_CP027357:89813-89971 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T98279 NZ_CP027357:89813-89971 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT98279 NZ_CP027357:c89764-89701 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|