Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 112242..112495 | Replicon | plasmid unnamed |
Accession | NZ_CP027343 | ||
Organism | Escherichia coli strain 2014C-4587 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A148HBD8 |
Locus tag | C6N23_RS26860 | Protein ID | WP_001336447.1 |
Coordinates | 112242..112391 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 112439..112495 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6N23_RS26820 | 109327..109566 | - | 240 | WP_001365702.1 | MarR family transcriptional regulator | - |
C6N23_RS26825 | 109579..109839 | - | 261 | WP_072122678.1 | hypothetical protein | - |
C6N23_RS26840 | 110542..111399 | - | 858 | WP_000130991.1 | incFII family plasmid replication initiator RepA | - |
C6N23_RS26845 | 111392..111466 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
C6N23_RS26855 | 111701..111958 | - | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
C6N23_RS26860 | 112242..112391 | - | 150 | WP_001336447.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 112439..112495 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 112439..112495 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 112439..112495 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 112439..112495 | + | 57 | NuclAT_1 | - | Antitoxin |
C6N23_RS26870 | 112670..113053 | - | 384 | WP_001109065.1 | hypothetical protein | - |
C6N23_RS26875 | 113156..113617 | - | 462 | WP_052892071.1 | thermonuclease family protein | - |
C6N23_RS26885 | 114716..115273 | - | 558 | WP_000139380.1 | fertility inhibition protein FinO | - |
C6N23_RS26890 | 115309..115677 | - | 369 | WP_000722534.1 | NirD/YgiW/YdeI family stress tolerance protein | - |
C6N23_RS26895 | 115760..116506 | - | 747 | WP_000205708.1 | type-F conjugative transfer system pilin acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | hlyD / hlyB / hlyA / hlyC / espP | 1..131410 | 131410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T98150 WP_001336447.1 NZ_CP027343:c112391-112242 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T98150 NZ_CP027343:c112391-112242 [Escherichia coli]
ATGACGAAATATACCCTTATTGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATACCCTTATTGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT98150 NZ_CP027343:112439-112495 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|