Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 930848..931068 | Replicon | chromosome |
Accession | NZ_CP027338 | ||
Organism | Escherichia coli strain 2014C-3051 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1PGT3 |
Locus tag | C6N28_RS05475 | Protein ID | WP_000170954.1 |
Coordinates | 930848..930955 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 931005..931068 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6N28_RS05450 | 926692..927774 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
C6N28_RS05455 | 927774..928607 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
C6N28_RS05460 | 928604..928996 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
C6N28_RS05465 | 929000..929809 | + | 810 | WP_001257045.1 | invasion regulator SirB1 | - |
C6N28_RS05470 | 929845..930699 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
C6N28_RS05475 | 930848..930955 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 931005..931068 | + | 64 | NuclAT_31 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_31 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_31 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_31 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_34 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_34 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_34 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_34 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_37 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_37 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_37 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_37 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_40 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_40 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_40 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_40 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_43 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_43 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_43 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_43 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_46 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_46 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_46 | - | Antitoxin |
- | 931005..931068 | + | 64 | NuclAT_46 | - | Antitoxin |
C6N28_RS05480 | 931383..931490 | - | 108 | WP_000170959.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 931543..931604 | + | 62 | NuclAT_30 | - | - |
- | 931543..931604 | + | 62 | NuclAT_30 | - | - |
- | 931543..931604 | + | 62 | NuclAT_30 | - | - |
- | 931543..931604 | + | 62 | NuclAT_30 | - | - |
- | 931543..931604 | + | 62 | NuclAT_33 | - | - |
- | 931543..931604 | + | 62 | NuclAT_33 | - | - |
- | 931543..931604 | + | 62 | NuclAT_33 | - | - |
- | 931543..931604 | + | 62 | NuclAT_33 | - | - |
- | 931543..931604 | + | 62 | NuclAT_36 | - | - |
- | 931543..931604 | + | 62 | NuclAT_36 | - | - |
- | 931543..931604 | + | 62 | NuclAT_36 | - | - |
- | 931543..931604 | + | 62 | NuclAT_36 | - | - |
- | 931543..931604 | + | 62 | NuclAT_39 | - | - |
- | 931543..931604 | + | 62 | NuclAT_39 | - | - |
- | 931543..931604 | + | 62 | NuclAT_39 | - | - |
- | 931543..931604 | + | 62 | NuclAT_39 | - | - |
- | 931543..931604 | + | 62 | NuclAT_42 | - | - |
- | 931543..931604 | + | 62 | NuclAT_42 | - | - |
- | 931543..931604 | + | 62 | NuclAT_42 | - | - |
- | 931543..931604 | + | 62 | NuclAT_42 | - | - |
- | 931543..931604 | + | 62 | NuclAT_45 | - | - |
- | 931543..931604 | + | 62 | NuclAT_45 | - | - |
- | 931543..931604 | + | 62 | NuclAT_45 | - | - |
- | 931543..931604 | + | 62 | NuclAT_45 | - | - |
- | 931543..931606 | + | 64 | NuclAT_16 | - | - |
- | 931543..931606 | + | 64 | NuclAT_16 | - | - |
- | 931543..931606 | + | 64 | NuclAT_16 | - | - |
- | 931543..931606 | + | 64 | NuclAT_16 | - | - |
- | 931543..931606 | + | 64 | NuclAT_18 | - | - |
- | 931543..931606 | + | 64 | NuclAT_18 | - | - |
- | 931543..931606 | + | 64 | NuclAT_18 | - | - |
- | 931543..931606 | + | 64 | NuclAT_18 | - | - |
- | 931543..931606 | + | 64 | NuclAT_20 | - | - |
- | 931543..931606 | + | 64 | NuclAT_20 | - | - |
- | 931543..931606 | + | 64 | NuclAT_20 | - | - |
- | 931543..931606 | + | 64 | NuclAT_20 | - | - |
- | 931543..931606 | + | 64 | NuclAT_22 | - | - |
- | 931543..931606 | + | 64 | NuclAT_22 | - | - |
- | 931543..931606 | + | 64 | NuclAT_22 | - | - |
- | 931543..931606 | + | 64 | NuclAT_22 | - | - |
- | 931543..931606 | + | 64 | NuclAT_24 | - | - |
- | 931543..931606 | + | 64 | NuclAT_24 | - | - |
- | 931543..931606 | + | 64 | NuclAT_24 | - | - |
- | 931543..931606 | + | 64 | NuclAT_24 | - | - |
- | 931543..931606 | + | 64 | NuclAT_26 | - | - |
- | 931543..931606 | + | 64 | NuclAT_26 | - | - |
- | 931543..931606 | + | 64 | NuclAT_26 | - | - |
- | 931543..931606 | + | 64 | NuclAT_26 | - | - |
C6N28_RS05490 | 931919..932026 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
- | 932074..932139 | + | 66 | NuclAT_29 | - | - |
- | 932074..932139 | + | 66 | NuclAT_29 | - | - |
- | 932074..932139 | + | 66 | NuclAT_29 | - | - |
- | 932074..932139 | + | 66 | NuclAT_29 | - | - |
- | 932074..932139 | + | 66 | NuclAT_32 | - | - |
- | 932074..932139 | + | 66 | NuclAT_32 | - | - |
- | 932074..932139 | + | 66 | NuclAT_32 | - | - |
- | 932074..932139 | + | 66 | NuclAT_32 | - | - |
- | 932074..932139 | + | 66 | NuclAT_35 | - | - |
- | 932074..932139 | + | 66 | NuclAT_35 | - | - |
- | 932074..932139 | + | 66 | NuclAT_35 | - | - |
- | 932074..932139 | + | 66 | NuclAT_35 | - | - |
- | 932074..932139 | + | 66 | NuclAT_38 | - | - |
- | 932074..932139 | + | 66 | NuclAT_38 | - | - |
- | 932074..932139 | + | 66 | NuclAT_38 | - | - |
- | 932074..932139 | + | 66 | NuclAT_38 | - | - |
- | 932074..932139 | + | 66 | NuclAT_41 | - | - |
- | 932074..932139 | + | 66 | NuclAT_41 | - | - |
- | 932074..932139 | + | 66 | NuclAT_41 | - | - |
- | 932074..932139 | + | 66 | NuclAT_41 | - | - |
- | 932074..932139 | + | 66 | NuclAT_44 | - | - |
- | 932074..932139 | + | 66 | NuclAT_44 | - | - |
- | 932074..932139 | + | 66 | NuclAT_44 | - | - |
- | 932074..932139 | + | 66 | NuclAT_44 | - | - |
- | 932074..932141 | + | 68 | NuclAT_15 | - | - |
- | 932074..932141 | + | 68 | NuclAT_15 | - | - |
- | 932074..932141 | + | 68 | NuclAT_15 | - | - |
- | 932074..932141 | + | 68 | NuclAT_15 | - | - |
- | 932074..932141 | + | 68 | NuclAT_17 | - | - |
- | 932074..932141 | + | 68 | NuclAT_17 | - | - |
- | 932074..932141 | + | 68 | NuclAT_17 | - | - |
- | 932074..932141 | + | 68 | NuclAT_17 | - | - |
- | 932074..932141 | + | 68 | NuclAT_19 | - | - |
- | 932074..932141 | + | 68 | NuclAT_19 | - | - |
- | 932074..932141 | + | 68 | NuclAT_19 | - | - |
- | 932074..932141 | + | 68 | NuclAT_19 | - | - |
- | 932074..932141 | + | 68 | NuclAT_21 | - | - |
- | 932074..932141 | + | 68 | NuclAT_21 | - | - |
- | 932074..932141 | + | 68 | NuclAT_21 | - | - |
- | 932074..932141 | + | 68 | NuclAT_21 | - | - |
- | 932074..932141 | + | 68 | NuclAT_23 | - | - |
- | 932074..932141 | + | 68 | NuclAT_23 | - | - |
- | 932074..932141 | + | 68 | NuclAT_23 | - | - |
- | 932074..932141 | + | 68 | NuclAT_23 | - | - |
- | 932074..932141 | + | 68 | NuclAT_25 | - | - |
- | 932074..932141 | + | 68 | NuclAT_25 | - | - |
- | 932074..932141 | + | 68 | NuclAT_25 | - | - |
- | 932074..932141 | + | 68 | NuclAT_25 | - | - |
C6N28_RS05495 | 932431..933531 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
C6N28_RS05500 | 933801..934031 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
C6N28_RS05505 | 934189..934884 | + | 696 | WP_106889271.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
C6N28_RS05510 | 934928..935281 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T98069 WP_000170954.1 NZ_CP027338:c930955-930848 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T98069 NZ_CP027338:c930955-930848 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 64 bp
>AT98069 NZ_CP027338:931005-931068 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|