Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 760650..760870 Replicon chromosome
Accession NZ_CP027331
Organism Escherichia coli strain 2013C-3277

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag MJ63_RS04360 Protein ID WP_000170954.1
Coordinates 760650..760757 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 760807..760870 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MJ63_RS04335 756494..757576 + 1083 WP_000804726.1 peptide chain release factor 1 -
MJ63_RS04340 757576..758409 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
MJ63_RS04345 758406..758798 + 393 WP_000200378.1 invasion regulator SirB2 -
MJ63_RS04350 758802..759611 + 810 WP_001257045.1 invasion regulator SirB1 -
MJ63_RS04355 759647..760501 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
MJ63_RS04360 760650..760757 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 760807..760870 + 64 NuclAT_31 - Antitoxin
- 760807..760870 + 64 NuclAT_31 - Antitoxin
- 760807..760870 + 64 NuclAT_31 - Antitoxin
- 760807..760870 + 64 NuclAT_31 - Antitoxin
- 760807..760870 + 64 NuclAT_34 - Antitoxin
- 760807..760870 + 64 NuclAT_34 - Antitoxin
- 760807..760870 + 64 NuclAT_34 - Antitoxin
- 760807..760870 + 64 NuclAT_34 - Antitoxin
- 760807..760870 + 64 NuclAT_37 - Antitoxin
- 760807..760870 + 64 NuclAT_37 - Antitoxin
- 760807..760870 + 64 NuclAT_37 - Antitoxin
- 760807..760870 + 64 NuclAT_37 - Antitoxin
- 760807..760870 + 64 NuclAT_40 - Antitoxin
- 760807..760870 + 64 NuclAT_40 - Antitoxin
- 760807..760870 + 64 NuclAT_40 - Antitoxin
- 760807..760870 + 64 NuclAT_40 - Antitoxin
- 760807..760870 + 64 NuclAT_43 - Antitoxin
- 760807..760870 + 64 NuclAT_43 - Antitoxin
- 760807..760870 + 64 NuclAT_43 - Antitoxin
- 760807..760870 + 64 NuclAT_43 - Antitoxin
- 760807..760870 + 64 NuclAT_46 - Antitoxin
- 760807..760870 + 64 NuclAT_46 - Antitoxin
- 760807..760870 + 64 NuclAT_46 - Antitoxin
- 760807..760870 + 64 NuclAT_46 - Antitoxin
MJ63_RS04365 761185..761292 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- 761345..761406 + 62 NuclAT_30 - -
- 761345..761406 + 62 NuclAT_30 - -
- 761345..761406 + 62 NuclAT_30 - -
- 761345..761406 + 62 NuclAT_30 - -
- 761345..761406 + 62 NuclAT_33 - -
- 761345..761406 + 62 NuclAT_33 - -
- 761345..761406 + 62 NuclAT_33 - -
- 761345..761406 + 62 NuclAT_33 - -
- 761345..761406 + 62 NuclAT_36 - -
- 761345..761406 + 62 NuclAT_36 - -
- 761345..761406 + 62 NuclAT_36 - -
- 761345..761406 + 62 NuclAT_36 - -
- 761345..761406 + 62 NuclAT_39 - -
- 761345..761406 + 62 NuclAT_39 - -
- 761345..761406 + 62 NuclAT_39 - -
- 761345..761406 + 62 NuclAT_39 - -
- 761345..761406 + 62 NuclAT_42 - -
- 761345..761406 + 62 NuclAT_42 - -
- 761345..761406 + 62 NuclAT_42 - -
- 761345..761406 + 62 NuclAT_42 - -
- 761345..761406 + 62 NuclAT_45 - -
- 761345..761406 + 62 NuclAT_45 - -
- 761345..761406 + 62 NuclAT_45 - -
- 761345..761406 + 62 NuclAT_45 - -
- 761345..761408 + 64 NuclAT_16 - -
- 761345..761408 + 64 NuclAT_16 - -
- 761345..761408 + 64 NuclAT_16 - -
- 761345..761408 + 64 NuclAT_16 - -
- 761345..761408 + 64 NuclAT_18 - -
- 761345..761408 + 64 NuclAT_18 - -
- 761345..761408 + 64 NuclAT_18 - -
- 761345..761408 + 64 NuclAT_18 - -
- 761345..761408 + 64 NuclAT_20 - -
- 761345..761408 + 64 NuclAT_20 - -
- 761345..761408 + 64 NuclAT_20 - -
- 761345..761408 + 64 NuclAT_20 - -
- 761345..761408 + 64 NuclAT_22 - -
- 761345..761408 + 64 NuclAT_22 - -
- 761345..761408 + 64 NuclAT_22 - -
- 761345..761408 + 64 NuclAT_22 - -
- 761345..761408 + 64 NuclAT_24 - -
- 761345..761408 + 64 NuclAT_24 - -
- 761345..761408 + 64 NuclAT_24 - -
- 761345..761408 + 64 NuclAT_24 - -
- 761345..761408 + 64 NuclAT_26 - -
- 761345..761408 + 64 NuclAT_26 - -
- 761345..761408 + 64 NuclAT_26 - -
- 761345..761408 + 64 NuclAT_26 - -
MJ63_RS04375 761721..761828 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 761876..761941 + 66 NuclAT_29 - -
- 761876..761941 + 66 NuclAT_29 - -
- 761876..761941 + 66 NuclAT_29 - -
- 761876..761941 + 66 NuclAT_29 - -
- 761876..761941 + 66 NuclAT_32 - -
- 761876..761941 + 66 NuclAT_32 - -
- 761876..761941 + 66 NuclAT_32 - -
- 761876..761941 + 66 NuclAT_32 - -
- 761876..761941 + 66 NuclAT_35 - -
- 761876..761941 + 66 NuclAT_35 - -
- 761876..761941 + 66 NuclAT_35 - -
- 761876..761941 + 66 NuclAT_35 - -
- 761876..761941 + 66 NuclAT_38 - -
- 761876..761941 + 66 NuclAT_38 - -
- 761876..761941 + 66 NuclAT_38 - -
- 761876..761941 + 66 NuclAT_38 - -
- 761876..761941 + 66 NuclAT_41 - -
- 761876..761941 + 66 NuclAT_41 - -
- 761876..761941 + 66 NuclAT_41 - -
- 761876..761941 + 66 NuclAT_41 - -
- 761876..761941 + 66 NuclAT_44 - -
- 761876..761941 + 66 NuclAT_44 - -
- 761876..761941 + 66 NuclAT_44 - -
- 761876..761941 + 66 NuclAT_44 - -
- 761876..761943 + 68 NuclAT_15 - -
- 761876..761943 + 68 NuclAT_15 - -
- 761876..761943 + 68 NuclAT_15 - -
- 761876..761943 + 68 NuclAT_15 - -
- 761876..761943 + 68 NuclAT_17 - -
- 761876..761943 + 68 NuclAT_17 - -
- 761876..761943 + 68 NuclAT_17 - -
- 761876..761943 + 68 NuclAT_17 - -
- 761876..761943 + 68 NuclAT_19 - -
- 761876..761943 + 68 NuclAT_19 - -
- 761876..761943 + 68 NuclAT_19 - -
- 761876..761943 + 68 NuclAT_19 - -
- 761876..761943 + 68 NuclAT_21 - -
- 761876..761943 + 68 NuclAT_21 - -
- 761876..761943 + 68 NuclAT_21 - -
- 761876..761943 + 68 NuclAT_21 - -
- 761876..761943 + 68 NuclAT_23 - -
- 761876..761943 + 68 NuclAT_23 - -
- 761876..761943 + 68 NuclAT_23 - -
- 761876..761943 + 68 NuclAT_23 - -
- 761876..761943 + 68 NuclAT_25 - -
- 761876..761943 + 68 NuclAT_25 - -
- 761876..761943 + 68 NuclAT_25 - -
- 761876..761943 + 68 NuclAT_25 - -
MJ63_RS04380 762233..763333 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
MJ63_RS04385 763603..763833 + 231 WP_001146442.1 putative cation transport regulator ChaB -
MJ63_RS04390 763991..764686 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
MJ63_RS04395 764730..765083 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T98017 WP_000170954.1 NZ_CP027331:c760757-760650 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T98017 NZ_CP027331:c760757-760650 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT98017 NZ_CP027331:760807-760870 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References