Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 69796..70060 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP027327 | ||
| Organism | Escherichia coli strain 2013C-4830 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | C6N65_RS28245 | Protein ID | WP_001303307.1 |
| Coordinates | 69796..69948 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 70003..70060 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6N65_RS28225 | 65264..67432 | + | 2169 | WP_063267537.1 | IncI1-type conjugal transfer membrane protein TraY | - |
| C6N65_RS28230 | 67508..68122 | + | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| C6N65_RS28235 | 68220..68429 | + | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| C6N65_RS28990 | 68638..68814 | + | 177 | WP_001054897.1 | hypothetical protein | - |
| C6N65_RS28240 | 69473..69724 | + | 252 | WP_001291965.1 | hypothetical protein | - |
| C6N65_RS28245 | 69796..69948 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| - | 70003..70060 | + | 58 | NuclAT_0 | - | Antitoxin |
| - | 70003..70060 | + | 58 | NuclAT_0 | - | Antitoxin |
| - | 70003..70060 | + | 58 | NuclAT_0 | - | Antitoxin |
| - | 70003..70060 | + | 58 | NuclAT_0 | - | Antitoxin |
| C6N65_RS28250 | 70240..71448 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| C6N65_RS28255 | 71467..72537 | + | 1071 | WP_059277929.1 | IncI1-type conjugal transfer protein TrbB | - |
| C6N65_RS28995 | 72530..73675 | + | 1146 | WP_199852764.1 | hypothetical protein | - |
| C6N65_RS29000 | 73996..74820 | + | 825 | WP_199852765.1 | icmO-like type IV secretion system domain protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..93170 | 93170 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T98012 WP_001303307.1 NZ_CP027327:c69948-69796 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T98012 NZ_CP027327:c69948-69796 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT98012 NZ_CP027327:70003-70060 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|