Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4704780..4705005 | Replicon | chromosome |
| Accession | NZ_CP027319 | ||
| Organism | Escherichia coli strain 2014C-3084 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | AAG01_RS22995 | Protein ID | WP_000813254.1 |
| Coordinates | 4704850..4705005 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 4704780..4704838 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAG01_RS22965 | 4699852..4699992 | + | 141 | Protein_4496 | Rha family transcriptional regulator | - |
| AAG01_RS22970 | 4700064..4701146 | + | 1083 | WP_032313415.1 | phage replisome organizer | - |
| AAG01_RS22975 | 4701153..4701899 | + | 747 | WP_000788742.1 | ATP-binding protein | - |
| AAG01_RS22980 | 4701921..4702691 | + | 771 | WP_000451007.1 | DUF1627 domain-containing protein | - |
| AAG01_RS22985 | 4702707..4703120 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
| AAG01_RS22990 | 4703472..4704245 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| AAG01_RS24225 | 4704507..4704590 | + | 84 | Protein_4502 | ORF6N domain-containing protein | - |
| - | 4704780..4704838 | - | 59 | - | - | Antitoxin |
| AAG01_RS22995 | 4704850..4705005 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| AAG01_RS23000 | 4705173..4705451 | + | 279 | WP_001341388.1 | hypothetical protein | - |
| AAG01_RS23005 | 4705453..4706502 | + | 1050 | WP_001265141.1 | DUF968 domain-containing protein | - |
| AAG01_RS23010 | 4706515..4706886 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AAG01_RS23015 | 4706876..4707247 | + | 372 | WP_000090265.1 | antiterminator Q family protein | - |
| AAG01_RS23020 | 4707399..4708217 | + | 819 | WP_000265267.1 | CPBP family intramembrane metalloprotease | - |
| AAG01_RS23025 | 4708504..4708701 | + | 198 | WP_000917737.1 | hypothetical protein | - |
| AAG01_RS23030 | 4708839..4709552 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T97952 WP_000813254.1 NZ_CP027319:4704850-4705005 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T97952 NZ_CP027319:4704850-4705005 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT97952 NZ_CP027319:c4704838-4704780 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|