Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2566583..2566844 | Replicon | chromosome |
| Accession | NZ_CP027319 | ||
| Organism | Escherichia coli strain 2014C-3084 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | V0YDF1 |
| Locus tag | AAG01_RS12980 | Protein ID | WP_001135738.1 |
| Coordinates | 2566583..2566735 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 2566810..2566844 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAG01_RS12950 | 2562681..2563340 | + | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
| AAG01_RS12955 | 2563444..2564418 | + | 975 | Protein_2548 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| AAG01_RS12960 | 2564468..2565178 | - | 711 | WP_000190516.1 | DUF3053 domain-containing protein | - |
| AAG01_RS12965 | 2565612..2565902 | + | 291 | WP_000455798.1 | HTH-type transcriptional regulator | - |
| AAG01_RS12970 | 2566183..2566395 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| AAG01_RS12975 | 2566535..2566606 | + | 72 | WP_212738361.1 | hypothetical protein | - |
| AAG01_RS12980 | 2566583..2566735 | - | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 2566810..2566844 | + | 35 | - | - | Antitoxin |
| AAG01_RS12985 | 2567062..2569131 | - | 2070 | WP_001291788.1 | glycine--tRNA ligase subunit beta | - |
| AAG01_RS12990 | 2569141..2570052 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| AAG01_RS12995 | 2570147..2570446 | - | 300 | WP_000980160.1 | YsaB family lipoprotein | - |
| AAG01_RS13000 | 2570621..2571616 | + | 996 | WP_001182639.1 | O-acetyltransferase WecH | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T97944 WP_001135738.1 NZ_CP027319:c2566735-2566583 [Escherichia coli]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
>T97944 NZ_CP027319:c2566735-2566583 [Escherichia coli]
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTGAAAGAGTAA
ATGCCGCAGAAATATAGATTGCTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTGAAAGAGTAA
Antitoxin
Download Length: 35 bp
>AT97944 NZ_CP027319:2566810-2566844 [Escherichia coli]
CACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
CACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|