Detailed information of TA system TA097940

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokW/Ldr(toxin)
• Location: 2540697..2540916
• Replicon: chromosome
• Accession: NZ_CP027319
• Organism: Escherichia coli strain 2014C-3084

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A7U9LZD1
• Locus tag: AAG01_RS12855
• Protein ID: WP_001401193.1
• Coordinates: 2540697..2540804 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	2540862..2540916 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
AAG01_RS12835 (2537511)	2537511..2537963	-	453	Protein_2525	cell division protein	-
AAG01_RS12840 (2537955)	2537955..2538746	+	792	Protein_2526	cellulose biosynthesis protein BcsE	-
AAG01_RS12845 (2538743)	2538743..2538934	+	192	WP_000988308.1	cellulose biosynthesis protein BcsF	-
AAG01_RS12850 (2538931)	2538931..2540610	+	1680	WP_106873546.1	cellulose biosynthesis protein BcsG	-
AAG01_RS12855 (2540697)	2540697..2540804	-	108	WP_001401193.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (2540862)	2540862..2540916	+	55	NuclAT_14	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_14	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_14	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_14	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_15	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_15	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_15	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_15	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_16	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_16	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_16	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_16	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_17	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_17	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_17	-	Antitoxin
- (2540862)	2540862..2540916	+	55	NuclAT_17	-	Antitoxin
- (2540862)	2540862..2540918	+	57	NuclAT_12	-	-
- (2540862)	2540862..2540918	+	57	NuclAT_12	-	-
- (2540862)	2540862..2540918	+	57	NuclAT_12	-	-
- (2540862)	2540862..2540918	+	57	NuclAT_12	-	-
- (2540862)	2540862..2540918	+	57	NuclAT_13	-	-
- (2540862)	2540862..2540918	+	57	NuclAT_13	-	-
- (2540862)	2540862..2540918	+	57	NuclAT_13	-	-
- (2540862)	2540862..2540918	+	57	NuclAT_13	-	-
AAG01_RS12860 (2541280)	2541280..2542551	+	1272	WP_001401191.1	aromatic amino acid transport family protein	-
AAG01_RS12865 (2542581)	2542581..2543585	-	1005	WP_000107036.1	dipeptide ABC transporter ATP-binding subunit DppF	-
AAG01_RS12870 (2543582)	2543582..2544565	-	984	WP_001196486.1	dipeptide ABC transporter ATP-binding protein	-
AAG01_RS12875 (2544576)	2544576..2545478	-	903	WP_000084677.1	dipeptide ABC transporter permease DppC	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3940.74 Da
• Isoelectric Point: 7.0034

>T97940 WP_001401193.1 NZ_CP027319:c2540804-2540697 [Escherichia coli]
MTLAELDMAFWHDLAAPVIAGILASMIVNWLNKRK

Nucleotide

• Length: 108 bp

>T97940 NZ_CP027319:c2540804-2540697 [Escherichia coli]
ATGACGCTCGCAGAGCTGGACATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAACGGAAGTAA

Antitoxin

Nucleotide

• Length: 55 bp

>AT97940 NZ_CP027319:2540862-2540916 [Escherichia coli]
CAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Toxin

• AlphaFold DB: A0A7U9LZD1

Antitoxin