Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 816620..816845 | Replicon | chromosome |
| Accession | NZ_CP027319 | ||
| Organism | Escherichia coli strain 2014C-3084 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | AAG01_RS04355 | Protein ID | WP_000813258.1 |
| Coordinates | 816620..816775 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 816787..816845 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAG01_RS04325 | 811873..813086 | + | 1214 | WP_136952279.1 | IS3 family transposase | - |
| AAG01_RS04330 | 813324..813521 | - | 198 | WP_000917763.1 | hypothetical protein | - |
| AAG01_RS04335 | 813765..814346 | - | 582 | WP_000211416.1 | ORF6N domain-containing protein | - |
| AAG01_RS04340 | 814620..815174 | - | 555 | WP_000640148.1 | DUF1133 family protein | - |
| AAG01_RS04345 | 815171..815461 | - | 291 | WP_000228019.1 | DUF1364 domain-containing protein | - |
| AAG01_RS04350 | 815461..816060 | - | 600 | WP_000940348.1 | DUF1367 family protein | - |
| AAG01_RS04355 | 816620..816775 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
| - | 816787..816845 | + | 59 | - | - | Antitoxin |
| AAG01_RS04360 | 817021..817125 | - | 105 | WP_001278450.1 | hypothetical protein | - |
| AAG01_RS04365 | 817241..817594 | - | 354 | WP_000610382.1 | DUF551 domain-containing protein | - |
| AAG01_RS04370 | 817591..817914 | - | 324 | WP_044788429.1 | hypothetical protein | - |
| AAG01_RS04375 | 817999..818211 | - | 213 | WP_000063625.1 | hypothetical protein | - |
| AAG01_RS04380 | 818260..818616 | - | 357 | WP_000403779.1 | hypothetical protein | - |
| AAG01_RS04385 | 818674..819069 | - | 396 | WP_001118155.1 | DUF977 family protein | - |
| AAG01_RS04390 | 819085..819855 | - | 771 | WP_032313847.1 | DUF1627 domain-containing protein | - |
| AAG01_RS04395 | 819877..820623 | - | 747 | WP_000788990.1 | ATP-binding protein | - |
| AAG01_RS04400 | 820630..821498 | - | 869 | Protein_871 | DUF1376 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleC | 775632..838859 | 63227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T97930 WP_000813258.1 NZ_CP027319:c816775-816620 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T97930 NZ_CP027319:c816775-816620 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACAGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACAGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT97930 NZ_CP027319:816787-816845 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|