Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 548783..549008 | Replicon | chromosome |
| Accession | NZ_CP027319 | ||
| Organism | Escherichia coli strain 2014C-3084 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | AAG01_RS03000 | Protein ID | WP_000813254.1 |
| Coordinates | 548853..549008 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 548783..548841 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAG01_RS02940 | 544123..544515 | + | 393 | WP_001141097.1 | DUF977 family protein | - |
| AAG01_RS02945 | 544512..544808 | + | 297 | WP_001266133.1 | DUF4406 domain-containing protein | - |
| AAG01_RS02950 | 544805..545180 | + | 376 | Protein_584 | ead/Ea22-like family protein | - |
| AAG01_RS02955 | 545158..545514 | + | 357 | WP_000403783.1 | hypothetical protein | - |
| AAG01_RS02960 | 545565..545777 | + | 213 | WP_000935422.1 | hypothetical protein | - |
| AAG01_RS02965 | 545811..545993 | + | 183 | WP_001224662.1 | hypothetical protein | - |
| AAG01_RS02970 | 545986..546162 | + | 177 | WP_000753069.1 | hypothetical protein | - |
| AAG01_RS24000 | 546159..546494 | + | 336 | Protein_589 | ead/Ea22-like family protein | - |
| AAG01_RS02980 | 546856..547212 | + | 357 | WP_000403779.1 | hypothetical protein | - |
| AAG01_RS02985 | 547261..547473 | + | 213 | WP_000063625.1 | hypothetical protein | - |
| AAG01_RS02990 | 547674..548387 | + | 714 | WP_000555106.1 | DUF551 domain-containing protein | - |
| AAG01_RS02995 | 548503..548607 | + | 105 | WP_001278450.1 | hypothetical protein | - |
| - | 548783..548841 | - | 59 | - | - | Antitoxin |
| AAG01_RS03000 | 548853..549008 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| AAG01_RS03005 | 549111..549428 | - | 318 | WP_000042395.1 | DNA-binding transcriptional regulator | - |
| AAG01_RS03010 | 549421..549792 | - | 372 | WP_001217944.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| AAG01_RS03015 | 550049..550243 | + | 195 | WP_000701093.1 | hypothetical protein | - |
| AAG01_RS03020 | 550297..550566 | + | 270 | WP_012817785.1 | hypothetical protein | - |
| AAG01_RS03025 | 550568..551617 | + | 1050 | WP_106873513.1 | DUF968 domain-containing protein | - |
| AAG01_RS03030 | 551631..552383 | + | 753 | WP_001047111.1 | antitermination protein | - |
| AAG01_RS03035 | 552665..552844 | + | 180 | WP_250220475.1 | site-specific DNA-methyltransferase | - |
| AAG01_RS03055 | 553225..553449 | + | 225 | WP_000735807.1 | hypothetical protein | - |
| AAG01_RS03060 | 553502..553711 | + | 210 | WP_000498121.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 516058..581428 | 65370 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T97927 WP_000813254.1 NZ_CP027319:548853-549008 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T97927 NZ_CP027319:548853-549008 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT97927 NZ_CP027319:c548841-548783 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|