Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 4806433..4806653 | Replicon | chromosome |
Accession | NZ_CP027255 | ||
Organism | Escherichia coli strain EC11 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | B7LGX8 |
Locus tag | C6C13_RS24680 | Protein ID | WP_000170965.1 |
Coordinates | 4806546..4806653 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 4806433..4806499 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C6C13_RS24650 | 4801712..4803106 | - | 1395 | WP_106022989.1 | inverse autotransporter invasin YchO | - |
C6C13_RS24655 | 4803291..4803644 | + | 354 | WP_001169666.1 | DsrE/F sulfur relay family protein YchN | - |
C6C13_RS24660 | 4803688..4804383 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
C6C13_RS24665 | 4804541..4804771 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
C6C13_RS24670 | 4805041..4806141 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
- | 4806433..4806499 | - | 67 | - | - | Antitoxin |
C6C13_RS24680 | 4806546..4806653 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4806966..4807029 | - | 64 | NuclAT_34 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_34 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_34 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_34 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_36 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_36 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_36 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_36 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_38 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_38 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_38 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_38 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_40 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_40 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_40 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_40 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_42 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_42 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_42 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_42 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_44 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_44 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_44 | - | - |
- | 4806966..4807029 | - | 64 | NuclAT_44 | - | - |
- | 4806967..4807029 | - | 63 | NuclAT_46 | - | - |
- | 4806967..4807029 | - | 63 | NuclAT_46 | - | - |
- | 4806967..4807029 | - | 63 | NuclAT_46 | - | - |
- | 4806967..4807029 | - | 63 | NuclAT_46 | - | - |
- | 4806967..4807029 | - | 63 | NuclAT_49 | - | - |
- | 4806967..4807029 | - | 63 | NuclAT_49 | - | - |
- | 4806967..4807029 | - | 63 | NuclAT_49 | - | - |
- | 4806967..4807029 | - | 63 | NuclAT_49 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_16 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_16 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_16 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_16 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_19 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_19 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_19 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_19 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_22 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_22 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_22 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_22 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_25 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_25 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_25 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_25 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_28 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_28 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_28 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_28 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_31 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_31 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_31 | - | - |
- | 4806968..4807029 | - | 62 | NuclAT_31 | - | - |
C6C13_RS24685 | 4807082..4807189 | + | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 4807503..4807569 | - | 67 | NuclAT_45 | - | - |
- | 4807503..4807569 | - | 67 | NuclAT_45 | - | - |
- | 4807503..4807569 | - | 67 | NuclAT_45 | - | - |
- | 4807503..4807569 | - | 67 | NuclAT_45 | - | - |
- | 4807503..4807569 | - | 67 | NuclAT_48 | - | - |
- | 4807503..4807569 | - | 67 | NuclAT_48 | - | - |
- | 4807503..4807569 | - | 67 | NuclAT_48 | - | - |
- | 4807503..4807569 | - | 67 | NuclAT_48 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_17 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_17 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_17 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_17 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_20 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_20 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_20 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_20 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_23 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_23 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_23 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_23 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_26 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_26 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_26 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_26 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_29 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_29 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_29 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_29 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_32 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_32 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_32 | - | - |
- | 4807504..4807567 | - | 64 | NuclAT_32 | - | - |
C6C13_RS26830 | 4807617..4807724 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
C6C13_RS24695 | 4807873..4808727 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
C6C13_RS24700 | 4808763..4809572 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
C6C13_RS24705 | 4809576..4809968 | - | 393 | WP_041327025.1 | invasion regulator SirB2 | - |
C6C13_RS24710 | 4809965..4810798 | - | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T97766 WP_000170965.1 NZ_CP027255:4806546-4806653 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T97766 NZ_CP027255:4806546-4806653 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT97766 NZ_CP027255:c4806499-4806433 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|