Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4806433..4806653 Replicon chromosome
Accession NZ_CP027255
Organism Escherichia coli strain EC11

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag C6C13_RS24680 Protein ID WP_000170965.1
Coordinates 4806546..4806653 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4806433..4806499 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C6C13_RS24650 4801712..4803106 - 1395 WP_106022989.1 inverse autotransporter invasin YchO -
C6C13_RS24655 4803291..4803644 + 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -
C6C13_RS24660 4803688..4804383 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
C6C13_RS24665 4804541..4804771 - 231 WP_001146442.1 putative cation transport regulator ChaB -
C6C13_RS24670 4805041..4806141 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 4806433..4806499 - 67 - - Antitoxin
C6C13_RS24680 4806546..4806653 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4806966..4807029 - 64 NuclAT_34 - -
- 4806966..4807029 - 64 NuclAT_34 - -
- 4806966..4807029 - 64 NuclAT_34 - -
- 4806966..4807029 - 64 NuclAT_34 - -
- 4806966..4807029 - 64 NuclAT_36 - -
- 4806966..4807029 - 64 NuclAT_36 - -
- 4806966..4807029 - 64 NuclAT_36 - -
- 4806966..4807029 - 64 NuclAT_36 - -
- 4806966..4807029 - 64 NuclAT_38 - -
- 4806966..4807029 - 64 NuclAT_38 - -
- 4806966..4807029 - 64 NuclAT_38 - -
- 4806966..4807029 - 64 NuclAT_38 - -
- 4806966..4807029 - 64 NuclAT_40 - -
- 4806966..4807029 - 64 NuclAT_40 - -
- 4806966..4807029 - 64 NuclAT_40 - -
- 4806966..4807029 - 64 NuclAT_40 - -
- 4806966..4807029 - 64 NuclAT_42 - -
- 4806966..4807029 - 64 NuclAT_42 - -
- 4806966..4807029 - 64 NuclAT_42 - -
- 4806966..4807029 - 64 NuclAT_42 - -
- 4806966..4807029 - 64 NuclAT_44 - -
- 4806966..4807029 - 64 NuclAT_44 - -
- 4806966..4807029 - 64 NuclAT_44 - -
- 4806966..4807029 - 64 NuclAT_44 - -
- 4806967..4807029 - 63 NuclAT_46 - -
- 4806967..4807029 - 63 NuclAT_46 - -
- 4806967..4807029 - 63 NuclAT_46 - -
- 4806967..4807029 - 63 NuclAT_46 - -
- 4806967..4807029 - 63 NuclAT_49 - -
- 4806967..4807029 - 63 NuclAT_49 - -
- 4806967..4807029 - 63 NuclAT_49 - -
- 4806967..4807029 - 63 NuclAT_49 - -
- 4806968..4807029 - 62 NuclAT_16 - -
- 4806968..4807029 - 62 NuclAT_16 - -
- 4806968..4807029 - 62 NuclAT_16 - -
- 4806968..4807029 - 62 NuclAT_16 - -
- 4806968..4807029 - 62 NuclAT_19 - -
- 4806968..4807029 - 62 NuclAT_19 - -
- 4806968..4807029 - 62 NuclAT_19 - -
- 4806968..4807029 - 62 NuclAT_19 - -
- 4806968..4807029 - 62 NuclAT_22 - -
- 4806968..4807029 - 62 NuclAT_22 - -
- 4806968..4807029 - 62 NuclAT_22 - -
- 4806968..4807029 - 62 NuclAT_22 - -
- 4806968..4807029 - 62 NuclAT_25 - -
- 4806968..4807029 - 62 NuclAT_25 - -
- 4806968..4807029 - 62 NuclAT_25 - -
- 4806968..4807029 - 62 NuclAT_25 - -
- 4806968..4807029 - 62 NuclAT_28 - -
- 4806968..4807029 - 62 NuclAT_28 - -
- 4806968..4807029 - 62 NuclAT_28 - -
- 4806968..4807029 - 62 NuclAT_28 - -
- 4806968..4807029 - 62 NuclAT_31 - -
- 4806968..4807029 - 62 NuclAT_31 - -
- 4806968..4807029 - 62 NuclAT_31 - -
- 4806968..4807029 - 62 NuclAT_31 - -
C6C13_RS24685 4807082..4807189 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4807503..4807569 - 67 NuclAT_45 - -
- 4807503..4807569 - 67 NuclAT_45 - -
- 4807503..4807569 - 67 NuclAT_45 - -
- 4807503..4807569 - 67 NuclAT_45 - -
- 4807503..4807569 - 67 NuclAT_48 - -
- 4807503..4807569 - 67 NuclAT_48 - -
- 4807503..4807569 - 67 NuclAT_48 - -
- 4807503..4807569 - 67 NuclAT_48 - -
- 4807504..4807567 - 64 NuclAT_17 - -
- 4807504..4807567 - 64 NuclAT_17 - -
- 4807504..4807567 - 64 NuclAT_17 - -
- 4807504..4807567 - 64 NuclAT_17 - -
- 4807504..4807567 - 64 NuclAT_20 - -
- 4807504..4807567 - 64 NuclAT_20 - -
- 4807504..4807567 - 64 NuclAT_20 - -
- 4807504..4807567 - 64 NuclAT_20 - -
- 4807504..4807567 - 64 NuclAT_23 - -
- 4807504..4807567 - 64 NuclAT_23 - -
- 4807504..4807567 - 64 NuclAT_23 - -
- 4807504..4807567 - 64 NuclAT_23 - -
- 4807504..4807567 - 64 NuclAT_26 - -
- 4807504..4807567 - 64 NuclAT_26 - -
- 4807504..4807567 - 64 NuclAT_26 - -
- 4807504..4807567 - 64 NuclAT_26 - -
- 4807504..4807567 - 64 NuclAT_29 - -
- 4807504..4807567 - 64 NuclAT_29 - -
- 4807504..4807567 - 64 NuclAT_29 - -
- 4807504..4807567 - 64 NuclAT_29 - -
- 4807504..4807567 - 64 NuclAT_32 - -
- 4807504..4807567 - 64 NuclAT_32 - -
- 4807504..4807567 - 64 NuclAT_32 - -
- 4807504..4807567 - 64 NuclAT_32 - -
C6C13_RS26830 4807617..4807724 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
C6C13_RS24695 4807873..4808727 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
C6C13_RS24700 4808763..4809572 - 810 WP_001257044.1 invasion regulator SirB1 -
C6C13_RS24705 4809576..4809968 - 393 WP_041327025.1 invasion regulator SirB2 -
C6C13_RS24710 4809965..4810798 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T97766 WP_000170965.1 NZ_CP027255:4806546-4806653 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T97766 NZ_CP027255:4806546-4806653 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT97766 NZ_CP027255:c4806499-4806433 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References